DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33226 and CG30289

DIOPT Version :9

Sequence 1:NP_995917.3 Gene:CG33226 / 2768859 FlyBaseID:FBgn0069056 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_726081.1 Gene:CG30289 / 246532 FlyBaseID:FBgn0050289 Length:316 Species:Drosophila melanogaster


Alignment Length:288 Identity:101/288 - (35%)
Similarity:147/288 - (51%) Gaps:26/288 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LVCFILALRSYESLGQDLLDPNCVQTPVGVRE------QILGGHNADIKLHPWMVQILQRGYHFC 72
            |||..:|..:..|   .||..||     |:.:      .|.||...:|:.:||||.:...  ..|
  Fly    11 LVCLFIANNNVMS---RLLVENC-----GISKDDPYVPNIFGGAKTNIQENPWMVLVWSS--KPC 65

  Fly    73 GGSLISSLFVLTAAHCHSRYRLKVRFGRYSGITPRYLCSSQYCSPFGPEIDVKRIFLHSSYRDYH 137
            |||||:..||||||||.|...|.||.|.|..:.|...|.:.:|.|....|.|....:|.:|....
  Fly    66 GGSLIARQFVLTAAHCVSFEDLYVRLGDYETLDPMPYCLNNHCIPKFYNISVDMKIVHENYNGIT 130

  Fly   138 -NYDIALFLLAKPVRYNVQTRPICVLQTSNKDKLRQFLNYVAMFNVTGWGKTESQLTSTILQTTS 201
             ..||||..:::.|.|:...||||:|       :.:.:..:.||.|||||:||....|.||...:
  Fly   131 LQNDIALLRMSEAVEYSDYVRPICLL-------VGEQMQSIPMFTVTGWGETEYGQFSRILLNAT 188

  Fly   202 LFHLDRKFCAQIFDRKIGWPHICAGHSQSSTCTGDSGGPLSAELTFSGVKRTVLFGIISYGAPNC 266
            |:::|..:|...|:::.....||||...|:||.||||||||::..:.....:..:|::|||:..|
  Fly   189 LYNMDISYCNIKFNKQADRSQICAGSHTSNTCKGDSGGPLSSKFHYGNRLLSFQYGLVSYGSERC 253

  Fly   267 --REVTVFTNVLRYSNWIRDIVHNFTPS 292
              ....|:|||..:..||.:.:..|.|:
  Fly   254 AANVAGVYTNVSYHREWIFNKMVQFKPT 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33226NP_995917.3 Tryp_SPc 47..285 CDD:238113 89/240 (37%)
Tryp_SPc 47..282 CDD:214473 87/237 (37%)
CG30289NP_726081.1 Tryp_SPc 42..271 CDD:214473 87/237 (37%)
Tryp_SPc 42..271 CDD:238113 87/237 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472850
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.790

Return to query results.
Submit another query.