DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33226 and CG30288

DIOPT Version :9

Sequence 1:NP_995917.3 Gene:CG33226 / 2768859 FlyBaseID:FBgn0069056 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_001097398.1 Gene:CG30288 / 246531 FlyBaseID:FBgn0050288 Length:282 Species:Drosophila melanogaster


Alignment Length:279 Identity:101/279 - (36%)
Similarity:148/279 - (53%) Gaps:15/279 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LLVCFILALRSYESLGQDLLDPNCVQTPV-GVREQILGGHNADIKLHPWMVQILQRGYHFCGGSL 76
            ::.|..:.:...|| |: ||:.:|..|.. |.|.:|.||.:|.::.:||||:::..|...|||||
  Fly    10 IVACLFIGIIRTES-GR-LLENDCGTTSSNGYRARIDGGRDAGMESNPWMVRVMISGKAVCGGSL 72

  Fly    77 ISSLFVLTAAHCHSRYRLKVRFGRYSGITPRYLCSSQYCSPFGPEIDVKRIFLHSSYRDYHNYDI 141
            |::.|||||.||.|...:.||.|.|....|.:.|....|:|....:||.|..:||:    ..|||
  Fly    73 ITARFVLTAEHCISPMYMNVRLGEYDTRHPIFDCDDFVCTPRAYNVDVDRKIVHSN----PGYDI 133

  Fly   142 ALFLLAKPVRYNVQTRPICVL--QTSNKDKLRQFLNYVAMFNVTGWGKTESQLTSTILQTTSLFH 204
            .|..:.:.|.::...||||::  :|...:.|.     :..||.||||..........|||.:|..
  Fly   134 GLLRMQRSVIFSNYVRPICLILGKTLGGNPLS-----ILRFNFTGWGTNSDGEEQDRLQTATLQQ 193

  Fly   205 LDRKFCAQIFDRKIGWPHICAGHSQSSTCTGDSGGPLSAELTFSGVKRTVLFGIISYGAPNCREV 269
            |.:..|.:. .|.:...:||||...|.:|.|||||||||..||.|..|...||:.|.|...|..:
  Fly   194 LPQWSCERP-GRPLDISYICAGSYISDSCKGDSGGPLSAIRTFEGQGRVFQFGVASQGLRLCSGL 257

  Fly   270 TVFTNVLRYSNWIRDIVHN 288
            .::|||..:::||.|::.|
  Fly   258 GIYTNVTHFTDWILDVIQN 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33226NP_995917.3 Tryp_SPc 47..285 CDD:238113 89/239 (37%)
Tryp_SPc 47..282 CDD:214473 87/236 (37%)
CG30288NP_001097398.1 Tryp_SPc 42..270 CDD:214473 87/237 (37%)
Tryp_SPc 45..270 CDD:238113 86/234 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472843
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.740

Return to query results.
Submit another query.