DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33226 and CG30187

DIOPT Version :9

Sequence 1:NP_995917.3 Gene:CG33226 / 2768859 FlyBaseID:FBgn0069056 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_001246475.2 Gene:CG30187 / 246509 FlyBaseID:FBgn0050187 Length:500 Species:Drosophila melanogaster


Alignment Length:284 Identity:96/284 - (33%)
Similarity:135/284 - (47%) Gaps:29/284 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IEFKMKWLLVCFILALRSYESLGQDL-LDPNCVQTPVGVREQILGGHNADIKLHPWMVQILQRGY 69
            ::.::.|:.|.|..    .:.:|..: ||..|   .:.:..:|.|||||..:...||..:..|.:
  Fly     1 MQTRLAWIPVIFWF----LKDVGASIFLDQIC---GINIALKITGGHNAAFQNSVWMAAVHNRTH 58

  Fly    70 HFCGGSLISSLFVLTAAHCHSRYRLK-VRFGRYSGITPRYLCSSQYCSPFGPEIDVKRIFLHSSY 133
            ..|||:||...||||||||.....:: |..|.|:...|            ....||....:|||:
  Fly    59 FICGGTLIHKRFVLTAAHCIVDQDVQSVSLGAYNKSDP------------ADRKDVITAVVHSSF 111

  Fly   134 ---RDYHNYDIALFLLAKPVRYNVQTRPICVLQTSNKDKLRQFLNYVAMFNVTGWGKTESQLTST 195
               ..|.| ||.|..|:..|.:|...||||::  .||.......| :..|...|||......||.
  Fly   112 DVRASYEN-DIGLLKLSSDVIFNALIRPICIV--LNKSMANHMRN-MRTFKAFGWGTLRGNKTSD 172

  Fly   196 ILQTTSLFHLDRKFCAQIFDRKIGWPHICAGHSQSSTCTGDSGGPLSAELTFSGV-KRTVLFGII 259
            ||||..|.||||:.|............||||.....||.|||||||:.::...|: .|.|.||||
  Fly   173 ILQTIILNHLDREECYMELSVYPSEKQICAGVPSGDTCGGDSGGPLTNDVFIQGIGNREVQFGII 237

  Fly   260 SYGAPNCREVTVFTNVLRYSNWIR 283
            |.|..:|....|:|:::.:::||:
  Fly   238 SVGKTSCDGQGVYTDLMSFADWIK 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33226NP_995917.3 Tryp_SPc 47..285 CDD:238113 89/242 (37%)
Tryp_SPc 47..282 CDD:214473 87/239 (36%)
CG30187NP_001246475.2 Tryp_SPc 35..260 CDD:214473 87/240 (36%)
Trypsin 316..>384 CDD:355628
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.860

Return to query results.
Submit another query.