DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33226 and CG30090

DIOPT Version :9

Sequence 1:NP_995917.3 Gene:CG33226 / 2768859 FlyBaseID:FBgn0069056 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_725487.1 Gene:CG30090 / 246448 FlyBaseID:FBgn0050090 Length:291 Species:Drosophila melanogaster


Alignment Length:284 Identity:106/284 - (37%)
Similarity:147/284 - (51%) Gaps:9/284 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 WLLVCFI--LALRSYESLGQ-DLLDPNCVQTPVGVREQILGGHNADIKLHPWMVQILQRGYHFCG 73
            |..:..|  ||:....|||. :.|:|.|..|...:..:|:||.:|.|..:|||..|.......||
  Fly     2 WGAIAAITALAIGVLCSLGNGEYLEPRCGLTANTIAFKIIGGRDAIINSNPWMAYIHSSVKLICG 66

  Fly    74 GSLISSLFVLTAAHC-HSRYRLKVRFGRYSGITPRYLCSSQYCSPFGPEIDVKRIFLHSSYRDYH 137
            |:||:..|||||||| :....:|||.|.|.. |....|:|:.|.|...|.||...|.|..:.:..
  Fly    67 GTLITQRFVLTAAHCVNEGSAVKVRLGEYDD-TATEDCNSKICIPRAEEHDVDMAFRHGKFSEIK 130

  Fly   138 NY-DIALFLLAKPVRYNVQTRPICVLQTSNKDKLRQFLNYVAMFNVTGWGKTESQLTSTILQTTS 201
            |. ||||..|||.|.:.....|||::..::|   |:.::.:..|..||||:|.:..|..:||.|.
  Fly   131 NLNDIALLRLAKFVTFKAHISPICIILGTSK---RELVDSIEWFVATGWGETRTHRTRGVLQITQ 192

  Fly   202 LFHLDRKFCAQIFDRKIGWPHICAGHSQSSTCTGDSGGPLSAELTFSGVKRTVLFGIISYGAPNC 266
            |...:...|.|...|.:....||||...|.||.|||||||...:......|.|.||::|||:..|
  Fly   193 LQRYNSSQCMQALGRLVQQNQICAGRLGSDTCNGDSGGPLFQTVRHMDKMRPVQFGVVSYGSREC 257

  Fly   267 REVTVFTNVLRYSNWIRDIVHNFT 290
            ..:.|:|:|..|::||..:|...|
  Fly   258 SGIGVYTDVYSYADWIATVVQQNT 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33226NP_995917.3 Tryp_SPc 47..285 CDD:238113 93/239 (39%)
Tryp_SPc 47..282 CDD:214473 91/236 (39%)
CG30090NP_725487.1 Tryp_SPc 39..273 CDD:214473 91/237 (38%)
Tryp_SPc 40..276 CDD:238113 93/239 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.760

Return to query results.
Submit another query.