DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33226 and CG30083

DIOPT Version :10

Sequence 1:NP_995917.3 Gene:CG33226 / 2768859 FlyBaseID:FBgn0069056 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_725492.3 Gene:CG30083 / 246444 FlyBaseID:FBgn0050083 Length:279 Species:Drosophila melanogaster


Alignment Length:129 Identity:25/129 - (19%)
Similarity:45/129 - (34%) Gaps:46/129 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   314 VPVATILNDLSPVPA--------------PVKVTNKITNSNPMSPMTPAGLQSNSPD-------- 356
            |.:..:|:.:||:|.              |::..:.|....|::..||...| |:|:        
  Fly    10 VGLLALLHGVSPLPTISSSSYGIDWSQVRPIEEFDHIKAHLPINLRTPIATQ-NAPNRRIVNGQE 73

  Fly   357 ---------VKAMRYYRLWIYTCNA-------VLLMAVIVFCGV-------AGKILLSDYKRLL 397
                     |..:..:...:..|.|       ||..|..|:.||       .|..:|..:.|::
  Fly    74 ARPGQFPYQVALLGQFNAGVGLCGASIITQRYVLTAAHCVYTGVDASAPVANGTAILGAHNRMI 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33226NP_995917.3 Tryp_SPc 47..285 CDD:238113
CG30083NP_725492.3 Tryp_SPc 34..255 CDD:238113 20/105 (19%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.