DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33226 and CG30082

DIOPT Version :9

Sequence 1:NP_995917.3 Gene:CG33226 / 2768859 FlyBaseID:FBgn0069056 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_001188942.1 Gene:CG30082 / 246443 FlyBaseID:FBgn0050082 Length:280 Species:Drosophila melanogaster


Alignment Length:290 Identity:105/290 - (36%)
Similarity:152/290 - (52%) Gaps:30/290 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 KMKWL-----LVCFILALRSYESLGQDLLDPNCVQT----PVGVREQILGGHNADIKLHPWMVQI 64
            |..|:     |||....||:      ..:||||..|    |.   .:|:||..|||..:||:..:
  Fly     2 KSLWIASFAFLVCLTPKLRA------QFIDPNCGTTINLPPT---NRIVGGRTADIGSNPWLAYL 57

  Fly    65 LQRGYHFCGGSLISSLFVLTAAHC-HSRYRLKVRFGRYSGITPRYLCSSQYCSPFGPEIDVKRIF 128
            .:.....|.|:||:..|||||||| ||.:.|.||.|.|...| |..|:|::|.|...|..|:..:
  Fly    58 HKNSSLVCTGTLITKRFVLTAAHCLHSFHLLTVRLGEYDTST-RIDCTSEFCIPTYEEYSVENAY 121

  Fly   129 LHSSY---RDYHNYDIALFLLAKPVRYNVQTRPICVLQTSNKDKLRQFLNYVAMFNVTGWGKTES 190
            :|:.:   :|..| ||.|..|...|.|.:..||||:.:...:      :.|.:.:...||||.:.
  Fly   122 IHTFFGGRQDSRN-DIGLLKLNGTVVYKLFIRPICLFRDPGQ------VPYSSTYEAAGWGKIDL 179

  Fly   191 QLTSTILQTTSLFHLDRKFCAQIFDRKIGWPHICAGHSQSSTCTGDSGGPLSAELTFSGVKRTVL 255
            ..|:|:|||.:|..||:..|.:.....:.:...|||..::.||:||||||||.:::...:.|||.
  Fly   180 INTATVLQTVNLIRLDQSDCERSLRTSLSYGQFCAGQWRADTCSGDSGGPLSRKMSNGRITRTVQ 244

  Fly   256 FGIISYGAPNCREVTVFTNVLRYSNWIRDI 285
            .||:|||...||...|:|.|..::|||..|
  Fly   245 LGIVSYGHYLCRGPGVYTYVPSFTNWILSI 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33226NP_995917.3 Tryp_SPc 47..285 CDD:238113 91/241 (38%)
Tryp_SPc 47..282 CDD:214473 89/238 (37%)
CG30082NP_001188942.1 Tryp_SPc 39..271 CDD:214473 89/239 (37%)
Tryp_SPc 40..274 CDD:238113 91/241 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.