DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33226 and Hgf

DIOPT Version :9

Sequence 1:NP_995917.3 Gene:CG33226 / 2768859 FlyBaseID:FBgn0069056 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_001276387.1 Gene:Hgf / 15234 MGIID:96079 Length:728 Species:Mus musculus


Alignment Length:283 Identity:69/283 - (24%)
Similarity:100/283 - (35%) Gaps:96/283 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 QTPVGVREQILGGHNADIKLHPWMVQILQRGYHFCGGSLISSLFVLTAAHCH-SRYRLKVRFGRY 101
            ||.||                 |||.:..|..|.||||||...:||||..|. :|.:....:..:
Mouse   503 QTTVG-----------------WMVSLKYRNKHICGGSLIKESWVLTARQCFPARNKDLKDYEAW 550

  Fly   102 SGI----------TPRYLCSSQYCSPFGPEIDVKRIFLHSSYRDYHNYDIALFLLAKPVRYNVQT 156
            .||          ..:.|..||..  :|||                ..|:.|..||:|       
Mouse   551 LGIHDVHERGEEKRKQILNISQLV--YGPE----------------GSDLVLLKLARP------- 590

  Fly   157 RPICVLQTSNKDKLRQFLNYVAMF---------------NVTGWGKTESQLTSTILQTTSLFHLD 206
               .:|.           |:|:..               ::.|||.|.......:|:...|:.:.
Mouse   591 ---AILD-----------NFVSTIDLPSYGCTIPEKTTCSIYGWGYTGLINADGLLRVAHLYIMG 641

  Fly   207 RKFCAQIFDRKI--GWPHICAGHSQ--SSTCTGDSGGPLSAELTFSGVKRTVLFGIISYG----A 263
            .:.|:|....|:  ....:|||..:  |..|.||.||||..|..    |..::.|:|..|    .
Mouse   642 NEKCSQHHQGKVTLNESELCAGAEKIGSGPCEGDYGGPLICEQH----KMRMVLGVIVPGRGCAI 702

  Fly   264 PNCREVTVFTNVLRYSNWIRDIV 286
            ||  ...:|..|..|:.||..::
Mouse   703 PN--RPGIFVRVAYYAKWIHKVI 723

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33226NP_995917.3 Tryp_SPc 47..285 CDD:238113 65/271 (24%)
Tryp_SPc 47..282 CDD:214473 63/268 (24%)
HgfNP_001276387.1 PAN_APPLE 41..123 CDD:238074
KR 127..209 CDD:214527
KR 211..289 CDD:214527
KR 305..385 CDD:214527
KR 389..471 CDD:238056
Tryp_SPc 495..719 CDD:214473 67/277 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833150
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.