DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33226 and Gzmk

DIOPT Version :9

Sequence 1:NP_995917.3 Gene:CG33226 / 2768859 FlyBaseID:FBgn0069056 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_032222.1 Gene:Gzmk / 14945 MGIID:1298232 Length:263 Species:Mus musculus


Alignment Length:290 Identity:78/290 - (26%)
Similarity:120/290 - (41%) Gaps:59/290 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 WLLVCFILALRSYESLGQDLLDPNCVQTPVGVREQILGGHNADIKLHPWMVQILQRGYHFCGGSL 76
            |.||..:..:         .:...|..|      :|:||........|:|..|..|..|.|||.|
Mouse     6 WALVSLVAGV---------YMSSECFHT------EIIGGREVQPHSRPFMASIQYRSKHICGGVL 55

  Fly    77 ISSLFVLTAAHCHSRYRLKVRFGRYSGITPRYLCSSQYCS---PFGPEIDVKRIFLHSSYRD-YH 137
            |...:|||||||:|.:.        .|.:|..:..:...|   |.....::|:....|..:. ..
Mouse    56 IHPQWVLTAAHCYSWFP--------RGHSPTVVLGAHSLSKNEPMKQTFEIKKFIPFSRLQSGSA 112

  Fly   138 NYDIALFLL--AKPVRYNVQTRPICVLQTSNKDKLRQFLNYVAMFNVTGWGKTESQL--TSTILQ 198
            ::||.|..|  |..:..|||     :|...:|:.||.    .....|||||.|:..|  .|..|:
Mouse   113 SHDIMLIKLRTAAELNKNVQ-----LLHLGSKNYLRD----GTKCQVTGWGTTKPDLLTASDTLR 168

  Fly   199 TTSLFHLDRKFC--AQIFDRK--IGWPHICAG--HSQSSTCTGDSGGPLSAELTFSGVKRTVLFG 257
            ..::..:.||.|  ...::.|  |....||||  ..|..:|.|||||||        :.:.:...
Mouse   169 EVTVTIISRKRCNSQSYYNHKPVITKDMICAGDARGQKDSCKGDSGGPL--------ICKGIFHA 225

  Fly   258 IISYGAPNC---REVTVFTNVL-RYSNWIR 283
            ::|.|. .|   ::..::|.:. :|..||:
Mouse   226 LVSQGY-KCGIAKKPGIYTLLTKKYQTWIK 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33226NP_995917.3 Tryp_SPc 47..285 CDD:238113 73/255 (29%)
Tryp_SPc 47..282 CDD:214473 71/252 (28%)
GzmkNP_032222.1 Tryp_SPc 25..253 CDD:214473 71/253 (28%)
Tryp_SPc 26..256 CDD:238113 73/255 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833161
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.