DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33226 and Gzma

DIOPT Version :9

Sequence 1:NP_995917.3 Gene:CG33226 / 2768859 FlyBaseID:FBgn0069056 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_034500.1 Gene:Gzma / 14938 MGIID:109266 Length:260 Species:Mus musculus


Alignment Length:266 Identity:79/266 - (29%)
Similarity:111/266 - (41%) Gaps:50/266 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 PVGVREQILGGHNADIKLHPWMVQILQRGYHFCGGSLISSLFVLTAAHCHSRYRLKVRFGRYSGI 104
            |.|..|:|:||........|:|..:.......|.|:||...:|||||||:...|.|...|.:| |
Mouse    22 PEGGCERIIGGDTVVPHSRPYMALLKLSSNTICAGALIEKNWVLTAAHCNVGKRSKFILGAHS-I 85

  Fly   105 TPRYLCSSQYCSPFGPE---IDVKRIFLHSSYRDY-HNYDIALFLLAKPVRYNVQTRPICVLQTS 165
            ...            ||   :.||:.|.:..|.:| ...|:.|..|.|....|   |.:.:|...
Mouse    86 NKE------------PEQQILTVKKAFPYPCYDEYTREGDLQLVRLKKKATVN---RNVAILHLP 135

  Fly   166 NK-DKLRQFLNYVAMFNVTGWGK-TESQLTSTILQTTSLFHLDRKFCAQIFDRK-------IGWP 221
            .| |.::.    .....|.|||: ......|..|:..::..:|||.|.   |.|       ||..
Mouse   136 KKGDDVKP----GTRCRVAGWGRFGNKSAPSETLREVNITVIDRKICN---DEKHYNFHPVIGLN 193

  Fly   222 HICAG--HSQSSTCTGDSGGPLSAELTFSGVKRTVLFGIISYGAPNC---REVTVFTNVL-RYSN 280
            .||||  .....:|.||||.||..:    |:.|    ||.|:|...|   |...|:|.:. ::.|
Mouse   194 MICAGDLRGGKDSCNGDSGSPLLCD----GILR----GITSFGGEKCGDRRWPGVYTFLSDKHLN 250

  Fly   281 WIRDIV 286
            ||:.|:
Mouse   251 WIKKIM 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33226NP_995917.3 Tryp_SPc 47..285 CDD:238113 75/256 (29%)
Tryp_SPc 47..282 CDD:214473 73/253 (29%)
GzmaNP_034500.1 Tryp_SPc 28..252 CDD:214473 73/254 (29%)
Tryp_SPc 29..255 CDD:238113 75/256 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833201
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.