DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33226 and CG12256

DIOPT Version :9

Sequence 1:NP_995917.3 Gene:CG33226 / 2768859 FlyBaseID:FBgn0069056 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_650166.2 Gene:CG12256 / 14462452 FlyBaseID:FBgn0038002 Length:283 Species:Drosophila melanogaster


Alignment Length:303 Identity:85/303 - (28%)
Similarity:132/303 - (43%) Gaps:63/303 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LLVCFILALRSYES--LGQDL-LDPNCVQTPVGVREQILGGHNA-DIKLHPWMV--QILQRG--- 68
            ||...:|||...:|  :|..: ||....:..:..:|:::||::. :.:..|:.|  |.|.|.   
  Fly    10 LLSSTLLALGGVQSKPMGNVIDLDKYFEEADLNSQERVVGGYDVPEDEYVPYQVSMQFLTRSGKM 74

  Fly    69 YHFCGGSLISSLFVLTAAHC---HSRYRLKVRFGRYSGITPRYLCSSQYCSPFGPEIDVKRIFLH 130
            .||||||||:...|||||||   .:..|:.|    .:||  |.|..|.     |....|:...::
  Fly    75 RHFCGGSLIAPNRVLTAAHCVNGQNASRISV----VAGI--RDLNDSS-----GFRSQVQSYEMN 128

  Fly   131 SSYRDYHNYDIALFLLAKPVRYNVQTRPICVLQTSNKDKL---RQFLNYVAMFNVTGWGKTESQL 192
            .:|::....|||:..:..|  :.:..:.:..:..|..|.:   ::.|       :||||......
  Fly   129 ENYQELVTSDIAILKIDPP--FELDEKRVSTIDVSGSDMVGADQEVL-------LTGWGSVFHFG 184

  Fly   193 TS------TILQTTSLFHLDRKFC----AQIFDRKIGWPHICA-GHSQSSTCTGDSGGPL---SA 243
            |.      |:||......|....|    .|:.|.:     ||| .......|.|||||||   |.
  Fly   185 TGPFAKYPTVLQKLDYKTLSNSKCKETMTQLTDTE-----ICALERFGKGACNGDSGGPLVMKSG 244

  Fly   244 ELTFSGVKRTVLFGIISYGAPNC--REVTVFTNVLRYSNWIRD 284
            | ::..|      |::|||...|  ....|:|.|..:..||::
  Fly   245 E-SYKQV------GVVSYGTAFCASNNPDVYTRVSMFDGWIKE 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33226NP_995917.3 Tryp_SPc 47..285 CDD:238113 75/266 (28%)
Tryp_SPc 47..282 CDD:214473 73/262 (28%)
CG12256NP_650166.2 Tryp_SPc 46..278 CDD:214473 73/263 (28%)
Tryp_SPc 47..280 CDD:238113 75/264 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.