DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33226 and CG43336

DIOPT Version :9

Sequence 1:NP_995917.3 Gene:CG33226 / 2768859 FlyBaseID:FBgn0069056 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_001247122.1 Gene:CG43336 / 12798414 FlyBaseID:FBgn0263041 Length:279 Species:Drosophila melanogaster


Alignment Length:287 Identity:100/287 - (34%)
Similarity:140/287 - (48%) Gaps:28/287 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LVCFILALRSYESLGQ-DLLDPNCVQTPVGVR------EQILGGHNADIKLHPWMVQILQR-GYH 70
            |..|:|.|     ||. ..||..|     |:|      .::..|..|.:...|||..:... |..
  Fly     8 LTFFLLPL-----LGSTQFLDMAC-----GIRAHSPSVPRVKNGTVASLTSSPWMAFLHSTDGRF 62

  Fly    71 FCGGSLISSLFVLTAAHCH-SRYRLKVRFGRYSGITPRY-LCSSQYCSPFGPEIDVKRIFLHSSY 133
            .||||||::..|||||||. .|..|..|.|.|.  ...| :|...||: :..|..|:|.|.|..|
  Fly    63 ICGGSLITNRLVLTAAHCFLDRTELVARLGEYD--REEYEMCHDSYCT-YRIEAMVERGFRHRHY 124

  Fly   134 RDY-HNYDIALFLLAKPVRYNVQTRPICVLQTSNKDKLRQFLNYVAMFNVTGWGKTESQLTSTIL 197
            ... ..||||:..|.:.|:|....||||::   ...:.|::::.:.....||||||||:..|..|
  Fly   125 NPMTMAYDIAILRLYRKVQYTDNIRPICIV---IDPRWRKYIDSLDPLTGTGWGKTESEGDSAKL 186

  Fly   198 QTTSLFHLDRKFCAQIFDRKIGWPHICAGHSQSSTCTGDSGGPLSAELTFSGVKRTVLFGIISYG 262
            :|..|.....:.|.:.....:.....|||:.:|:.|.||||||:.|.:.:...||.|..||.|:.
  Fly   187 RTVDLARKHPEVCRRYATLSLTANQFCAGNERSNLCNGDSGGPVGALIPYGKSKRFVQVGIASFT 251

  Fly   263 APNCREVTVFTNVLRYSNWIRDIVHNF 289
            ...|..|:|||:|:.|.:||. .|||:
  Fly   252 NTQCVMVSVFTDVMSYVDWIL-AVHNY 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33226NP_995917.3 Tryp_SPc 47..285 CDD:238113 86/241 (36%)
Tryp_SPc 47..282 CDD:214473 84/238 (35%)
CG43336NP_001247122.1 Tryp_SPc 37..271 CDD:214473 84/239 (35%)
Tryp_SPc 40..271 CDD:238113 84/236 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.760

Return to query results.
Submit another query.