DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33226 and CG43335

DIOPT Version :9

Sequence 1:NP_995917.3 Gene:CG33226 / 2768859 FlyBaseID:FBgn0069056 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_001247121.1 Gene:CG43335 / 12798413 FlyBaseID:FBgn0263040 Length:281 Species:Drosophila melanogaster


Alignment Length:263 Identity:90/263 - (34%)
Similarity:139/263 - (52%) Gaps:11/263 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 LLDPNC-VQT-PVGVREQILGGHNADIKLHPWMVQILQRGYHFCGGSLISSLFVLTAAHC-HSRY 92
            ||:||| ::| |...|.:|:||.:|:|..||||..:....::||.|:||::.|||||||| .:..
  Fly    24 LLEPNCGIRTMPSFHRTRIIGGSDAEITSHPWMAYLYNEFHYFCAGTLITNQFVLTAAHCIEASK 88

  Fly    93 RLKVRFGRYSGITPRYLCSSQYCSPFGPEIDVKRIFLHSSYR-DYHNYDIALFLLAKPVRYNVQT 156
            .|.||.|. ||:|   ......|.....:..|.....|..:. .....|||:..||:.|::....
  Fly    89 NLTVRLGG-SGLT---RSDGSMCQITAEDYSVSMAIKHKYFTPSIMLNDIAMIRLARTVKFYDHI 149

  Fly   157 RPICVLQTSNKDKLRQFLNYVAMFNVTGWGKTESQLTSTILQTTSLFHLDRKFCAQIFDRKIGWP 221
            ||||::.   ...:|..|........||||..:.::...:||...:..::|..|::::|..|...
  Fly   150 RPICIIL---DPAVRLLLEDGMTLMATGWGLADKRMHPHLLQEAPITVMNRNVCSKLYDVAITQG 211

  Fly   222 HICAGHSQSSTCTGDSGGPLSAELTFSGVKRTVLFGIISYGAPNCREVTVFTNVLRYSNWIRDIV 286
            .||||..:::||.|||||||...:.:.|..|.|.:||.|:|...||..:::|::..||.||..:|
  Fly   212 QICAGDKETNTCLGDSGGPLGGVVNYYGDLRFVQYGITSFGDIECRSPSIYTDLSTYSGWINMVV 276

  Fly   287 HNF 289
            ..:
  Fly   277 SQY 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33226NP_995917.3 Tryp_SPc 47..285 CDD:238113 81/239 (34%)
Tryp_SPc 47..282 CDD:214473 79/236 (33%)
CG43335NP_001247121.1 Tryp_SPc 41..272 CDD:214473 79/237 (33%)
Tryp_SPc 42..275 CDD:238113 81/239 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.760

Return to query results.
Submit another query.