DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33226 and si:dkey-32n7.7

DIOPT Version :9

Sequence 1:NP_995917.3 Gene:CG33226 / 2768859 FlyBaseID:FBgn0069056 Length:292 Species:Drosophila melanogaster
Sequence 2:XP_021335883.1 Gene:si:dkey-32n7.7 / 108191692 ZFINID:ZDB-GENE-121214-179 Length:609 Species:Danio rerio


Alignment Length:275 Identity:71/275 - (25%)
Similarity:109/275 - (39%) Gaps:62/275 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 CVQTPVGVREQILGGHNADIKLHPWMVQILQRGYHFCGGSLISSLFVLTAAHCHSRYRLKVRFGR 100
            |...||......:||.|:.....||...:.......||||||:..:||:||||.:        |:
Zfish   297 CGIIPVNSSNGTVGGQNSSAVHWPWQASLYWYSGQTCGGSLINKEWVLSAAHCFN--------GQ 353

  Fly   101 YSGITPRYLCSSQYCSPFGP---EIDVKRIFLHSSYR-DYHNYDIALFLLAKPVRYNVQTRPICV 161
            .:|.....:...:..:.:.|   ...||.:..|..|. :.::.||||..|:.|:.:....||:|:
Zfish   354 RNGFYLTVILGPKTQNKYDPSRISRSVKAVIKHPYYNPNTNDNDIALVRLSFPITFTDSIRPVCL 418

  Fly   162 LQTSNKDKLRQFLNYVAMFNVTGWGKTESQLTS-------------TILQTTSLFHLDRKFC--- 210
            ....            ::||    ..|||.:|:             .|.|...:..:..:.|   
Zfish   419 AAEG------------SVFN----SDTESWITTWRNISDGVPLPSPKIFQEVEVPVIGNRQCNCL 467

  Fly   211 ---AQIFDRKIGWPHICAG--HSQSSTCTGDSGGPLSAELTFSGVKRTVLFGIISYGAPNCREVT 270
               ..|.|..     ||||  ......|.||||||:.:..:...|:.    ||:|:|: .|.:..
Zfish   468 YGVGSITDNM-----ICAGLLKEGKDLCQGDSGGPMVSNQSSVWVQS----GIVSFGS-GCAQSE 522

  Fly   271 ---VFTNVLRYSNWI 282
               |:|.|.||..||
Zfish   523 FPGVYTRVSRYQEWI 537

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33226NP_995917.3 Tryp_SPc 47..285 CDD:238113 68/264 (26%)
Tryp_SPc 47..282 CDD:214473 66/262 (25%)
si:dkey-32n7.7XP_021335883.1 NIDO 4..63 CDD:310601
NIDO 141..272 CDD:322035
Tryp_SPc 309..537 CDD:238113 66/261 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.