DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33226 and plaua

DIOPT Version :9

Sequence 1:NP_995917.3 Gene:CG33226 / 2768859 FlyBaseID:FBgn0069056 Length:292 Species:Drosophila melanogaster
Sequence 2:XP_017214157.1 Gene:plaua / 100008445 ZFINID:ZDB-GENE-090313-278 Length:421 Species:Danio rerio


Alignment Length:293 Identity:76/293 - (25%)
Similarity:131/293 - (44%) Gaps:43/293 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LRSYESLGQDLLDP----------------NCVQTPVGVREQILGGHNADIKLHPWMVQILQRGY 69
            :|.|.::.|:.:.|                .|.:..:..:.:|:||..:.::..|||..|.:...
Zfish   122 VREYCNIPQEAIKPVKRPPTPEPIKQDTELTCGERRLDRQTKIIGGLRSTVESQPWMAAIFKGDG 186

  Fly    70 HFCGGSLISSLFVLTAAHCHSRYRLKVRFGRYSGITPRYLCSSQYCSPFGPE-IDVKRIFLHSSY 133
            ..|||:||:..:|||||||....: :.:..|||.:..:...:.  ..|...: ..|.|:.:|..:
Zfish   187 FICGGTLITPCWVLTAAHCFPTGK-RTQINRYSVVLGKNAINE--TDPVKEQKFTVSRLVIHEDF 248

  Fly   134 RDY----HNYDIALFLLAK-PVRYNVQTRPICVLQTSNKDKLRQFLNYVAMFNVTGWGKTESQL- 192
             ||    :.:||||..:.. ..:..|:|:.:   :|:.....:|.|.......:.|:|:.:... 
Zfish   249 -DYSTENYTHDIALLKIEDCNGQCAVKTKTV---RTACLPPFQQMLPVGFYCEIAGYGRYQKGTF 309

  Fly   193 -TSTILQTTSLFHLDRKFCAQIFDRK--IGWPHICAGHS--QSSTCTGDSGGPLSAELTFSGVKR 252
             .|..|:.|.:..:.:|.|.:.:..|  :....:||...  ::..|.|||||||..|:.    ..
Zfish   310 KFSRYLKQTEVKLISQKVCQRTYYNKDEVNENMLCANGRDWKTDACQGDSGGPLVCEVN----NI 370

  Fly   253 TVLFGIISYGAPNCREVT---VFTNVLRYSNWI 282
            ..||||||:| ..|.|..   |:|.|..|:.||
Zfish   371 MFLFGIISWG-KECAEKNQPGVYTQVSNYNQWI 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33226NP_995917.3 Tryp_SPc 47..285 CDD:238113 71/251 (28%)
Tryp_SPc 47..282 CDD:214473 69/249 (28%)
plauaXP_017214157.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170575883
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.