DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr1 and PAPLN

DIOPT Version :9

Sequence 1:NP_001286645.1 Gene:dpr1 / 2768858 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_001352835.1 Gene:PAPLN / 89932 HGNCID:19262 Length:1278 Species:Homo sapiens


Alignment Length:280 Identity:64/280 - (22%)
Similarity:91/280 - (32%) Gaps:88/280 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 PSNLLPYFDFDVPRNLTVTVGQTGFLHCRVERLGDKDVSWIRKRDLHILTAGGTTYTSDQRFQVL 112
            |:|.| ..|.:.||.:..:.||...:.||.|......:.|  :||       |.. .|..|.| |
Human  1039 PANRL-RLDQNQPRVVDASPGQRIRMTCRAEGFPPPAIEW--QRD-------GQP-VSSPRHQ-L 1091

  Fly   113 RPDGSANWTLQIKYPQPRDSGVYECQINTEPKMSLSYTFNVVE-----LKAEIFG-------PSD 165
            :||||    |.|......|.|.|.|           ..||..:     ::..:.|       |..
Human  1092 QPDGS----LVISRVAVEDGGFYTC-----------VAFNGQDRDQRWVQLRVLGELTISGLPPT 1141

  Fly   166 LMVKTGSDINLTCKIMQGPHELGNIFWYKGSEMLDGKGENEIDSSMARIRVEDDWTDGLTSRLKI 230
            :.|..|....|.| ::.|  |..||.|.:....:...|.        |:....|.|      |.|
Human  1142 VTVPEGDTARLLC-VVAG--ESVNIRWSRNGLPVQADGH--------RVHQSPDGT------LLI 1189

  Fly   231 KRAMPGDTGNYTC-----VPTVAKTSSVYVHVIIGEHPAAMQHNSSSN----------------- 273
            ......|.|:|||     ...|::::.|.|   :...|.|...:...:                 
Human  1190 YNLRARDEGSYTCSAYQGSQAVSRSTEVKV---VSPAPTAQPRDPGRDCVDQPELANCDLILQAQ 1251

  Fly   274 --SNSFYCGICCMLLSIVSC 291
              .|.:|...||     .||
Human  1252 LCGNEYYSSFCC-----ASC 1266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr1NP_001286645.1 Ig 59..154 CDD:299845 27/94 (29%)
IG_like 60..150 CDD:214653 25/89 (28%)
IG_like 163..257 CDD:214653 24/98 (24%)
Ig 174..244 CDD:143165 18/74 (24%)
PAPLNNP_001352835.1 TSP1 29..80 CDD:214559
ADAM_spacer1 183..298 CDD:310520
TSP1 308..361 CDD:214559
TSP1 369..424 CDD:214559
TSP1 424..481 CDD:214559
TSP1 488..539 CDD:214559
Kunitz_BPTI 753..805 CDD:278443
Papilin_u7 814..905 CDD:318767
Ig 914..>978 CDD:325142
I-set 1049..1119 CDD:254352 27/95 (28%)
IG 1139..1219 CDD:214652 23/96 (24%)
PLAC 1235..1267 CDD:312271 6/37 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.