DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr1 and KIRREL3

DIOPT Version :9

Sequence 1:NP_001286645.1 Gene:dpr1 / 2768858 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster
Sequence 2:XP_011541328.1 Gene:KIRREL3 / 84623 HGNCID:23204 Length:809 Species:Homo sapiens


Alignment Length:240 Identity:58/240 - (24%)
Similarity:93/240 - (38%) Gaps:42/240 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 PRNLTVTVGQTGFLHCRVERLGDKDVSWIRKRDLHILTAG-GTTYTSDQRFQVLRPDGSANWTLQ 123
            |::..|..||...|.|.:... |..|.||:..    |..| |...:|..::.|:....|....|:
Human    60 PQDQVVVSGQPVTLLCAIPEY-DGFVLWIKDG----LALGVGRDLSSYPQYLVVGNHLSGEHHLK 119

  Fly   124 IKYPQPRDSGVYECQ-----INTEPKMSLSYTFNVVELKAEIFGPSDLMVKTGSDINLTCKIMQG 183
            |...:.:|..|||||     |.:.|   ...|..|......|.|...:.::.|..:||||. ...
Human   120 ILRAELQDDAVYECQAIQAAIRSRP---ARLTV
LVPPDDPVILGGPVISLRAGDPLNLTCH-ADN 180

  Fly   184 PHELGNIFWYKGSEMLDGKGENEIDSSMARIRVEDDWTDGLTSRLKIKRAMPGDTGN---YTCVP 245
            .....:|.|.:..|:::|       ::.::..:.|...:.:.|.|.|.   |||..|   ..|..
Human   181 AKPAASIIWLRKGEVING-------ATYSKTLLRDGKRESIVSTLFIS---PGDVENGQSIVCRA 235

  Fly   246 T-----VAKTSSVYVHVIIGEHPAAM------QHNSSSNSNSFYC 279
            |     ..|.:||.:.:   :||..:      |.....|..:|:|
Human   236 TNKAIPGGKETSVTIDI---QHPPLVNLSVEPQPVLEDNVVTFHC 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr1NP_001286645.1 Ig 59..154 CDD:299845 27/99 (27%)
IG_like 60..150 CDD:214653 26/95 (27%)
IG_like 163..257 CDD:214653 22/101 (22%)
Ig 174..244 CDD:143165 16/72 (22%)
KIRREL3XP_011541328.1 Ig 58..149 CDD:299845 26/96 (27%)
IG_like 60..149 CDD:214653 26/96 (27%)
I-set 156..249 CDD:254352 23/103 (22%)
Ig2_KIRREL3-like 171..252 CDD:143236 21/91 (23%)
Ig_2 260..337 CDD:290606 4/18 (22%)
I-set 341..422 CDD:254352
IGc2 355..406 CDD:197706
Ig5_KIRREL3 424..521 CDD:143306
IG_like 432..521 CDD:214653
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.