DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr1 and KIRREL2

DIOPT Version :9

Sequence 1:NP_001286645.1 Gene:dpr1 / 2768858 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_954649.3 Gene:KIRREL2 / 84063 HGNCID:18816 Length:708 Species:Homo sapiens


Alignment Length:231 Identity:53/231 - (22%)
Similarity:83/231 - (35%) Gaps:51/231 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 PYFDFDVPRNLTVTVGQTGFLHCRVERLGDKDVSWIRKRDLHILTAGGTTYTSDQRFQVLRPDGS 117
            |:| ...|.:|.|.:|:...|.|.:...... |.|.:..    |..||         |...|..|
Human    24 PHF-LQQPEDLVVLLGEEARLPCALGAYWGL-VQWTKSG----LALGG---------QRDLPGWS 73

  Fly   118 ANW----------TLQIKYPQPRDSGVYECQINTEPKMSLSYTFNVV---ELKAEIFGPSDLMVK 169
            ..|          .|.|:..:..|...||||.......|.....:|:   |....:.|||..:| 
Human    74 RYWISGNAANGQHDLHIRPVELEDEASYECQATQAGLRSRPAQLHVLVPPEAPQVLGGPSVSLV- 137

  Fly   170 TGSDINLTCKIMQGPHELGNIFWYKGSEMLDGKGENE----------IDSSMARIRVEDDWTDGL 224
            .|...||||:..........:.|::...:|||...::          ::|::.......|  ||.
Human   138 AGVPANLTCRSRGDARPTPELLWFRDGVLLDGATFHQTLLKEGTPGSVESTLTLTPFSHD--DGA 200

  Fly   225 TSRLKIK-RAMPGDTGNYTCV-------PTVAKTSS 252
            |...:.: :|:|  ||..|.:       |.|..::|
Human   201 TFVCRARSQALP--TGRDTAITLSLQYPPEVTLSAS 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr1NP_001286645.1 Ig 59..154 CDD:299845 23/104 (22%)
IG_like 60..150 CDD:214653 23/99 (23%)
IG_like 163..257 CDD:214653 25/108 (23%)
Ig 174..244 CDD:143165 18/80 (23%)
KIRREL2NP_954649.3 IG_like 30..119 CDD:214653 23/102 (23%)
IGc2 38..106 CDD:197706 19/81 (23%)
I-set 126..224 CDD:254352 23/102 (23%)
Ig2_KIRREL3-like 141..223 CDD:143236 18/85 (21%)
Cell attachment site. /evidence=ECO:0000255 149..151 0/1 (0%)
Ig 231..306 CDD:299845 1/4 (25%)
IG_like 234..308 CDD:214653 1/1 (100%)
Ig 312..395 CDD:299845
I-set 317..395 CDD:254352
Ig 397..501 CDD:299845
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 545..601
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.