DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr1 and cxadr

DIOPT Version :9

Sequence 1:NP_001286645.1 Gene:dpr1 / 2768858 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_694480.1 Gene:cxadr / 791793 ZFINID:ZDB-GENE-020814-2 Length:372 Species:Danio rerio


Alignment Length:365 Identity:73/365 - (20%)
Similarity:134/365 - (36%) Gaps:101/365 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 WLLLLSMVLLRGYNAALAPTPPTTSTTTISPSNLLPYFDFDVPRNLTVTVGQTGFLHCRV----E 78
            :|.:..::||.|....|..|  :|..|:|..::                 |::..|.|:.    :
Zfish     7 FLCVTYVILLTGSACGLQIT--STGQTSIEKAS-----------------GESVKLDCQFTLASD 52

  Fly    79 RLGDKDVSWI------RKRDLHILTAGGTTYTSDQRFQ-----------VLRPD---GSANWTLQ 123
            ..|..|:.|.      :|.:..::     .|:.|:.|:           ...||   |.|  ::.
Zfish    53 DSGPLDIEWSLQPSDNQKEEKVVI-----VYSGDRAFEHYYDPLKGRVHFNSPDPKNGDA--SMN 110

  Fly   124 IKYPQPRDSGVYECQINTEPKM-SLSYTFNVVELKAEIFGPSDLMVKTGSDINLTCKIMQGPHEL 187
            |...:..|:|.|:|:|...|.: |..|...|:...::....::.....|.::.|.|..::|...:
Zfish   111 IMGLKATDTGTYQCKIKKVPGIASRKYLLTVMVRPSKPKCSAEGQTYVGKNMVLKCSSVEGTQPM 175

  Fly   188 GNIFWYKGSEMLDGKGENEIDSSMARIRVEDDWTDGLTSRLKIKRAMPGDTGNYTCVPTVAK--- 249
            ..| |.:.|       .|::...:|.:       |.:|..:.:|.|....:|.|.|   .||   
Zfish   176 EYI-WERTS-------GNKLLPPLAIL-------DKVTGTMTLKNATGDASGTYRC---QAKNRV 222

  Fly   250 -TSSVYVHVIIGEHPAAMQHNSSSNSNSFYCG--ICCMLLSIV------SCCLQHF---YETGCG 302
             |....|.|.|.:.|         |:.....|  ||.:||.|:      .||....   ||....
Zfish   223 GTEECVVEVTITQPP---------NTAGIIAGVIICILLLLILLALILFCCCRARHKKKYEKEIA 278

  Fly   303 YLHAAAALAKSAGLGPPKRATLTTSETGISAAEVAAAAGA 342
            |     .:.:..   ||.::.::|:.:..|.....::.|:
Zfish   279 Y-----EIREDV---PPPKSRVSTARSFTSVGSQRSSLGS 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr1NP_001286645.1 Ig 59..154 CDD:299845 23/119 (19%)
IG_like 60..150 CDD:214653 22/114 (19%)
IG_like 163..257 CDD:214653 20/97 (21%)
Ig 174..244 CDD:143165 14/69 (20%)
cxadrNP_694480.1 V-set 28..141 CDD:284989 26/136 (19%)
IG_like 32..141 CDD:214653 24/132 (18%)
I-set 141..233 CDD:254352 22/109 (20%)
Ig_3 147..220 CDD:290638 17/90 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 286..352 5/25 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.