DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr1 and Mxra8

DIOPT Version :9

Sequence 1:NP_001286645.1 Gene:dpr1 / 2768858 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_077225.4 Gene:Mxra8 / 74761 MGIID:1922011 Length:442 Species:Mus musculus


Alignment Length:381 Identity:80/381 - (20%)
Similarity:124/381 - (32%) Gaps:149/381 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LLNWLIGWLLLL---SMVLLRGYNAALAPTPPTTSTTTISPSNLLPYFDFDVPRNLTVTVGQTGF 72
            ||:.::.|.|||   |.||..|.:...|.:....|.:.:|                 :..|....
Mouse     3 LLSRVLLWKLLLLQSSAVLSSGPSGTAAASSSLVSESVVS-----------------LAAGTQAV 50

  Fly    73 LHCR-------VERLGDKD--VSW--------IRKRDLHILTAGGTTYTSDQRFQ--------VL 112
            |.|:       .:||.|:.  |.|        .|:|.:.:.:||      :||..        :|
Mouse    51 LRCQSPRMVWTQDRLHDRQRVVHWDLSGGPGSQRRRLVDMYSAG------EQRVYEPRDRDRLLL 109

  Fly   113 RP----DGSANWTLQIKYPQPRDSGVYEC-----------------QINTEPKMSLSYTFNVVEL 156
            .|    ||  |::|.|:.....|.|||.|                 ::..:|.:|.:|.....|:
Mouse   110 SPSAFHDG--NFSLLIRAVDRGDEGVYTCNLHHHYCHLDESLAVRLEVTEDPLLSRAYWDGEKEV 172

  Fly   157 KAEIFGPSDLMVKTGSDINLTCKIMQGPHELGNIFWYKGSEMLDGKGENEIDSSMARIRVEDDWT 221
                     |:|..|:...:||                                :.|..|   ||
Mouse   173 ---------LVVAHGAPALMTC--------------------------------INRAHV---WT 193

  Fly   222 D-GLTSRLKI---KRAMPGDTGNYTCVPTVAKTSSVYVHVIIGEH----PAAMQHNSSSNSNSFY 278
            | .|....::   .|.:||.:.:     ...:...:|..   ||.    |..::...|.|:|:|.
Mouse   194 DRHLEEAQQVVHWDRQLPGVSHD-----RADRLLDLYAS---GERRAYGPPFLRDRVSVNTNAFA 250

  Fly   279 CGICCMLL--------SIVSCCLQHFYETGCGYLHAAAAL---AKSAGLGPPKRAT 323
            .|...:.:        .|.||.|.|.|   || ||.....   .......||.||:
Mouse   251 RGDFSLRIDELERADEGIYSCHLHHHY---CG-LHERRVFHLQVTEPAFEPPARAS 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr1NP_001286645.1 Ig 59..154 CDD:299845 29/140 (21%)
IG_like 60..150 CDD:214653 28/135 (21%)
IG_like 163..257 CDD:214653 15/97 (15%)
Ig 174..244 CDD:143165 11/73 (15%)
Mxra8NP_077225.4 V-set 46..156 CDD:284989 26/117 (22%)
RGD 1. /evidence=ECO:0000305|PubMed:18366072 128..130 0/1 (0%)
V-set 171..291 CDD:284989 34/175 (19%)
RGD 2. /evidence=ECO:0000305|PubMed:18366072 251..253 0/1 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 296..319 4/7 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.