Sequence 1: | NP_001286645.1 | Gene: | dpr1 / 2768858 | FlyBaseID: | FBgn0040726 | Length: | 367 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001137799.1 | Gene: | DIP-epsilon / 7354433 | FlyBaseID: | FBgn0259714 | Length: | 467 | Species: | Drosophila melanogaster |
Alignment Length: | 225 | Identity: | 64/225 - (28%) |
---|---|---|---|
Similarity: | 92/225 - (40%) | Gaps: | 39/225 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 58 DVPRNLTVTVGQTGFLHCRVERLGDKDVSWIRKRDLHILTAGGTTYTSDQRFQVL--RPDGSANW 120
Fly 121 TLQIKYPQPRDSGVYECQINTEPKMSLSYTFNVVELKAEI---FGPSDLMVKTGSDINLTCKIMQ 182
Fly 183 GPHELGNIFWYK--GSEMLDGKGENEIDSSMARIRVEDDWTDGLTSRLKIKRAMPGDTGNYTCV- 244
Fly 245 -----PTVAKTSSVYV---------HVIIG 260 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dpr1 | NP_001286645.1 | Ig | 59..154 | CDD:299845 | 33/96 (34%) |
IG_like | 60..150 | CDD:214653 | 30/91 (33%) | ||
IG_like | 163..257 | CDD:214653 | 26/110 (24%) | ||
Ig | 174..244 | CDD:143165 | 16/71 (23%) | ||
DIP-epsilon | NP_001137799.1 | IG_like | 59..155 | CDD:214653 | 33/96 (34%) |
Ig | 69..139 | CDD:143165 | 22/69 (32%) | ||
IG_like | 165..249 | CDD:214653 | 25/99 (25%) | ||
IGc2 | 172..237 | CDD:197706 | 18/80 (23%) | ||
IG_like | 267..348 | CDD:214653 | |||
Ig | 270..339 | CDD:299845 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 46 | 1.000 | Domainoid score | I11916 |
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |