Sequence 1: | NP_001286645.1 | Gene: | dpr1 / 2768858 | FlyBaseID: | FBgn0040726 | Length: | 367 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_006510620.1 | Gene: | Kirrel3 / 67703 | MGIID: | 1914953 | Length: | 803 | Species: | Mus musculus |
Alignment Length: | 240 | Identity: | 58/240 - (24%) |
---|---|---|---|
Similarity: | 93/240 - (38%) | Gaps: | 42/240 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 60 PRNLTVTVGQTGFLHCRVERLGDKDVSWIRKRDLHILTAG-GTTYTSDQRFQVLRPDGSANWTLQ 123
Fly 124 IKYPQPRDSGVYECQ-----INTEPKMSLSYTFNVVELKAEIFGPSDLMVKTGSDINLTCKIMQG 183
Fly 184 PHELGNIFWYKGSEMLDGKGENEIDSSMARIRVEDDWTDGLTSRLKIKRAMPGDTGN---YTCVP 245
Fly 246 T-----VAKTSSVYVHVIIGEHPAAM------QHNSSSNSNSFYC 279 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dpr1 | NP_001286645.1 | Ig | 59..154 | CDD:299845 | 27/99 (27%) |
IG_like | 60..150 | CDD:214653 | 26/95 (27%) | ||
IG_like | 163..257 | CDD:214653 | 22/101 (22%) | ||
Ig | 174..244 | CDD:143165 | 16/72 (22%) | ||
Kirrel3 | XP_006510620.1 | IG_like | 54..143 | CDD:214653 | 26/96 (27%) |
Ig strand A' | 56..60 | CDD:409353 | 0/3 (0%) | ||
Ig strand B | 64..71 | CDD:409353 | 2/6 (33%) | ||
Ig strand C | 78..82 | CDD:409353 | 2/3 (67%) | ||
Ig strand C' | 84..87 | CDD:409353 | 1/6 (17%) | ||
Ig strand D | 97..101 | CDD:409353 | 0/3 (0%) | ||
Ig strand E | 104..116 | CDD:409353 | 3/11 (27%) | ||
Ig strand G | 132..143 | CDD:409353 | 2/13 (15%) | ||
IgI_2_KIRREL3-like | 149..246 | CDD:409416 | 24/107 (22%) | ||
Ig strand B | 166..170 | CDD:409416 | 2/3 (67%) | ||
Ig strand C | 180..184 | CDD:409416 | 1/3 (33%) | ||
Ig strand E | 210..214 | CDD:409416 | 2/3 (67%) | ||
Ig strand F | 224..229 | CDD:409416 | 1/4 (25%) | ||
Ig strand G | 239..242 | CDD:409416 | 0/2 (0%) | ||
Ig | <267..334 | CDD:416386 | 2/5 (40%) | ||
Ig strand B | 267..274 | CDD:409353 | 2/5 (40%) | ||
Ig strand C | 279..286 | CDD:409353 | |||
Ig strand C' | 288..291 | CDD:409353 | |||
Ig strand D | 298..302 | CDD:409353 | |||
Ig strand E | 304..310 | CDD:409353 | |||
Ig strand G | 321..334 | CDD:409353 | |||
Ig | 335..416 | CDD:416386 | |||
Ig strand A' | 343..347 | CDD:409353 | |||
Ig strand B | 350..360 | CDD:409353 | |||
Ig strand C | 365..371 | CDD:409353 | |||
Ig strand E | 381..387 | CDD:409353 | |||
IgI_5_KIRREL3 | 418..515 | CDD:409479 | |||
Ig strand B | 436..440 | CDD:409479 | |||
Ig strand C | 450..454 | CDD:409479 | |||
Ig strand E | 481..485 | CDD:409479 | |||
Ig strand F | 496..501 | CDD:409479 | |||
Ig strand G | 509..512 | CDD:409479 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |