DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment dpr1 and Sirpb1b

DIOPT Version :9

Sequence 1:	NP_001286645.1	Gene:	dpr1 / 2768858	FlyBaseID:	FBgn0040726	Length:	367	Species:	Drosophila melanogaster
Sequence 2:	XP_006530146.1	Gene:	Sirpb1b / 668101	MGIID:	3779828	Length:	408	Species:	Mus musculus

Alignment Length:	102	Identity:	30/102 - (29%)
Similarity:	39/102 - (38%)	Gaps:	24/102 - (23%)

- Green bases have known domain annotations that are detailed below.

  Fly   155 ELKAEIFGP-SDLMVKTGSDINLTCKIMQ----GPHELGNIFWYKG---SEML--DGKGENEIDS 209
            |||  :..| ....|..|....|.|.:..    ||     |.||:|   |.:|  ...||:
Mouse    30 ELK--VIQPVKSFFVGAGGSATLNCTVTSLLPVGP-----IRWYRGVGQSRLLIQSFTGEH---- 83

  Fly   210 SMARIRVEDDWT--DGLTSRLKIKRAMPGDTGNYTCV 244
             ..||....|.|  :.|...::|....|.|:|.|.||
Mouse    84 -FPRITSVSDVTKRNNLDFSIRISNVTPADSGTYYCV 119

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
dpr1	NP_001286645.1	Ig	59..154	CDD:299845
		IG_like	60..150	CDD:214653
		IG_like	163..257	CDD:214653	27/94 (29%)
		Ig	174..244	CDD:143165	22/80 (28%)
Sirpb1b	XP_006530146.1	Ig	32..143	CDD:386229	28/100 (28%)
		IgC_SIRP_domain_2	145..248	CDD:319314
		IgC_SIRP_domain_3	250..352	CDD:319334
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	1	1.000	41	1.000	Domainoid score	I12440
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	1.000