DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr1 and Btnl6

DIOPT Version :9

Sequence 1:NP_001286645.1 Gene:dpr1 / 2768858 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_109672.1 Gene:Btnl6 / 624681 MGIID:1932038 Length:539 Species:Mus musculus


Alignment Length:248 Identity:51/248 - (20%)
Similarity:86/248 - (34%) Gaps:73/248 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LLSMVLLRGYNAALAPTPPTTST---TTISPSNLLPYFDFDVPRNLTVTVGQTGFLHCRVERLGD 82
            |||.|..:.:. ...|:.|..:.   ..|.|.:::|..:                    ||.:  
Mouse    22 LLSWVTTKEFQ-VFGPSDPIVAAPGGEAILPCSVIPAMN--------------------VENM-- 63

  Fly    83 KDVSWIRKRDLHILTAGGTTYTS------------DQRFQVLRP---DGSANWTLQIKYPQPRDS 132
            :::.|.|.|    .:|....|..            .||..:::.   .|:|  .::|...|..||
Mouse    64 EELRWFRSR----FSAAVLVYRDQEEQKREQLPEYSQRTSLVKEQFHQGTA--AVRILNVQAPDS 122

  Fly   133 GVYECQINTEPKMSLSYTFNVVELKAEIFGP-SDLMVKTGSD--INLTCKIMQGPHELGNIFWYK 194
            |:|.|..    |..:.|...::|||....|. .::.:|...|  :.:.| |..|        ||.
Mouse   123 GIYICHF----KQGVFYEEAILELKVAAMGSVPEVYIKGPEDGGVCVVC-ITSG--------WYP 174

  Fly   195 GSEM--LDGKGENEIDSSMARIRVEDDWTDGL--TSRLKIKRAMPGDTGNYTC 243
            ..::  .|.:||    ...|.:.:..:...||  |....:.|  .....|.||
Mouse   175 EPQVHWKDSRGE----KLTASLEIHSEDAQGLFRTETSLVVR--DSSVRNVTC 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr1NP_001286645.1 Ig 59..154 CDD:299845 20/109 (18%)
IG_like 60..150 CDD:214653 19/104 (18%)
IG_like 163..257 CDD:214653 18/88 (20%)
Ig 174..244 CDD:143165 16/74 (22%)
Btnl6NP_109672.1 Ig 45..145 CDD:386229 26/131 (20%)
Ig 150..232 CDD:386229 18/87 (21%)
SPRY_PRY_C-I_1 341..503 CDD:293968
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.