DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr1 and ROBO2

DIOPT Version :9

Sequence 1:NP_001286645.1 Gene:dpr1 / 2768858 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster
Sequence 2:XP_011532283.1 Gene:ROBO2 / 6092 HGNCID:10250 Length:1597 Species:Homo sapiens


Alignment Length:281 Identity:65/281 - (23%)
Similarity:104/281 - (37%) Gaps:75/281 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LLLLSMVLLRGYNAALAPTPPTTSTTTISP--------SNLLPYFDF-----DVPRNLTVTVGQT 70
            ||.:.|:.|.|         ||.|..|.:|        .:.|...||     :.|.::.|:.|:.
Human    15 LLFVLMLFLSG---------PTLSKLTRTPWKGKPWKGGSRLRQEDFPPRIVEHPSDVIVSKGEP 70

  Fly    71 GFLHCRVERLGDKDVSWIRKRDLHILTAGGTTYTSD----QRFQVLRPDGSANWTLQI---KYPQ 128
            ..|:|:.|......:.|.:         .|....:|    :..::|.|.||. :.|:|   :..:
Human    71 TTLNCKAEGRPTPTIEWYK---------DGERVETDKDDPRSHRMLLPSGSL-FFLRIVHGRRSK 125

  Fly   129 PRDSGVYECQINTEPKMSLSYTFNVVELKAEI----------FGPSDLMVKTGSDINLTCKIMQG 183
            | |.|.|.|       ::.:|....|...|.:          ..|:|::|..|....|.|:..:|
Human   126 P-DEGSYVC-------VARNYLGEAVSRNASLEVALLRDDFRQNPTDVVVAAGEPAILECQPPRG 182

  Fly   184 PHELGNIFWYKGSEMLDGKGENEIDSSMARIRVEDDWTDGLTSRLKIKRAMPGDTGNYTCVPT-- 246
             |....|:|.|....:|.|.|        ||.:..       .:|.|......|.|.||||.|  
Human   183 -HPEPTIYWKKDKVRIDDKEE--------RISIRG-------GKLMISNTRKSDAGMYTCVGTNM 231

  Fly   247 VAKTSSVYVHVIIGEHPAAMQ 267
            |.:..|....:.:.|.|..::
Human   232 VGERDSDPAELTVFERPTFLR 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr1NP_001286645.1 Ig 59..154 CDD:299845 21/101 (21%)
IG_like 60..150 CDD:214653 20/96 (21%)
IG_like 163..257 CDD:214653 27/95 (28%)
Ig 174..244 CDD:143165 18/69 (26%)
ROBO2XP_011532283.1 Ig1_Robo 53..152 CDD:143317 23/116 (20%)
Ig 160..244 CDD:325142 27/99 (27%)
Ig 265..333 CDD:325142
Ig4_Robo 355..444 CDD:143203
IG 451..532 CDD:214652
FN3 549..642 CDD:238020
FN3 673..758 CDD:238020
FN3 766..859 CDD:238020
PTN13_u3 <1374..>1431 CDD:318742
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.