DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr1 and nitr4a

DIOPT Version :9

Sequence 1:NP_001286645.1 Gene:dpr1 / 2768858 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_571729.1 Gene:nitr4a / 60652 ZFINID:ZDB-GENE-001106-11 Length:337 Species:Danio rerio


Alignment Length:265 Identity:60/265 - (22%)
Similarity:90/265 - (33%) Gaps:98/265 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 LTVTVGQTGFLHC--------RV----ERLGDKDVSWIRKRDLHILTAGGTTYTSDQRFQVLRPD 115
            ||...|....|.|        ||    :.||:|.|..:............:.:...|||..:|..
Zfish    31 LTTQEGHIVLLPCLLLEDNFHRVIWYKQVLGEKPVVIVSSYHHSQPNEFSSDFKETQRFHAVRKA 95

  Fly   116 GSANWTLQIKYPQPRDSGVYECQINTEPKMSLSYTFNV------------VELK-AEIFGPSDLM 167
            .|.|  |.|:.....|||.|.|        ..::|..|            .:|| |.|..|...:
Zfish    96 DSFN--LTIRRTLKSDSGTYFC--------GSAFTHVVSFGTGTILLVK
GADLKPAVIQLPVHAV 150

  Fly   168 VKTGSDINLTCKIMQGPHELG--NIFWYK--------GSEMLDGKGENE-IDSSMARIRVEDDWT 221
            :|.||::.|.|.:.....:.|  :::|::        |.....||.:|| .|||           
Zfish   151 IKPGSNVTLRCSVEGKTCDKGVQSVYWFRQSSSTTHQGIVYTHGKSKNECADSS----------- 204

  Fly   222 DGLTSRLKIKRAMPGDTGNYTCVPTVAKTSSVYVHVIIGEHPAAMQHNSSSNSNSFYCGICCMLL 286
                           ||  .:|:..:||.|   |:|              |.:..:||       
Zfish   205 ---------------DT--QSCLQNLAKMS---VNV--------------SEAGLYYC------- 228

  Fly   287 SIVSC 291
            |:|:|
Zfish   229 SVVTC 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr1NP_001286645.1 Ig 59..154 CDD:299845 26/114 (23%)
IG_like 60..150 CDD:214653 24/98 (24%)
IG_like 163..257 CDD:214653 23/104 (22%)
Ig 174..244 CDD:143165 14/80 (18%)
nitr4aNP_571729.1 Ig 24..134 CDD:299845 26/112 (23%)
IG_like 29..127 CDD:214653 26/105 (25%)
V-set 144..246 CDD:284989 30/142 (21%)
IG_like 146..246 CDD:214653 30/140 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1457433at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.