DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr1 and nitr3a

DIOPT Version :9

Sequence 1:NP_001286645.1 Gene:dpr1 / 2768858 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_571727.1 Gene:nitr3a / 60649 ZFINID:ZDB-GENE-001106-8 Length:337 Species:Danio rerio


Alignment Length:205 Identity:42/205 - (20%)
Similarity:75/205 - (36%) Gaps:38/205 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 GQTGFLHCRVER---LGDKDVSWIRKRDLHILTAGGTTYTSDQRF-QVLRPDGSANWTLQIKYPQ 128
            |.:..|.|.|..   .|...|.|.:....:  :..|..||.|.|. |.|:....:::.....|..
Zfish   155 GDSVTLQCSVSSHICAGHYRVYWFKHSSGY--SQPGIIYTHDNRSDQCLKSSEKSSFVQSCVYSL 217

  Fly   129 PR------DSGVYECQINTEPKMSLSYTFNVVELKAE---IFGPSDLMVKTGSDINLTCKIMQGP 184
            .:      |:|||.|.::|..|:...   |..:|..|   .:.|..:::.|.|..::...|:   
Zfish   218 SQTELTTSDAGVYYCAVDTCGKIHFG---NGTKLTI
EASFFWNPVAVILFTISVTSIVVNIV--- 276

  Fly   185 HELGNIFWYKGSEMLDGKGENEIDSSMARIRVEDDWTDGLT-SRLKIKRAMPGDTGNYTCVPTVA 248
                         ::..|...:..:...|.::....||.|. :.|...:..| .|...:.:.|:.
Zfish   277 -------------LVIQKNRRKETTEHLRSQINQIETDDLNYAALHFSKTKP-TTSRRSSMKTIQ 327

  Fly   249 KT--SSVYVH 256
            :|  |...||
Zfish   328 ETIYSETTVH 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr1NP_001286645.1 Ig 59..154 CDD:299845 23/95 (24%)
IG_like 60..150 CDD:214653 22/91 (24%)
IG_like 163..257 CDD:214653 17/97 (18%)
Ig 174..244 CDD:143165 9/70 (13%)
nitr3aNP_571727.1 V-set 26..130 CDD:284989
IG_like 27..132 CDD:214653
V-set 145..250 CDD:284989 24/99 (24%)
IG_like 154..250 CDD:214653 24/99 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1457433at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.