Sequence 1: | NP_001286645.1 | Gene: | dpr1 / 2768858 | FlyBaseID: | FBgn0040726 | Length: | 367 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_571727.1 | Gene: | nitr3a / 60649 | ZFINID: | ZDB-GENE-001106-8 | Length: | 337 | Species: | Danio rerio |
Alignment Length: | 205 | Identity: | 42/205 - (20%) |
---|---|---|---|
Similarity: | 75/205 - (36%) | Gaps: | 38/205 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 68 GQTGFLHCRVER---LGDKDVSWIRKRDLHILTAGGTTYTSDQRF-QVLRPDGSANWTLQIKYPQ 128
Fly 129 PR------DSGVYECQINTEPKMSLSYTFNVVELKAE---IFGPSDLMVKTGSDINLTCKIMQGP 184
Fly 185 HELGNIFWYKGSEMLDGKGENEIDSSMARIRVEDDWTDGLT-SRLKIKRAMPGDTGNYTCVPTVA 248
Fly 249 KT--SSVYVH 256 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dpr1 | NP_001286645.1 | Ig | 59..154 | CDD:299845 | 23/95 (24%) |
IG_like | 60..150 | CDD:214653 | 22/91 (24%) | ||
IG_like | 163..257 | CDD:214653 | 17/97 (18%) | ||
Ig | 174..244 | CDD:143165 | 9/70 (13%) | ||
nitr3a | NP_571727.1 | V-set | 26..130 | CDD:284989 | |
IG_like | 27..132 | CDD:214653 | |||
V-set | 145..250 | CDD:284989 | 24/99 (24%) | ||
IG_like | 154..250 | CDD:214653 | 24/99 (24%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1457433at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.010 |