DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr1 and nitr2b

DIOPT Version :9

Sequence 1:NP_001286645.1 Gene:dpr1 / 2768858 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_571724.1 Gene:nitr2b / 60647 ZFINID:ZDB-GENE-001106-6 Length:313 Species:Danio rerio


Alignment Length:265 Identity:66/265 - (24%)
Similarity:94/265 - (35%) Gaps:75/265 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 LSYTFNVVELKAEIFGPSDLM-VKTGSDINLTCKIMQGPHE-LGNIFW---------------YK 194
            |.|........|:|.|.:.:| |:.|..:||||..   |.| ..::.|               |:
Zfish     9 LLYLLTCTSDNADIKGQNHVMIVQAGVAVNLTCIF---PKESRTSVVWVKQRVGEKPLLIASAYQ 70

  Fly   195 GSEMLDGKGENEIDSSMARIRVEDDWTDGLTSRLKIKRAMPGDTGNYTCVPTVAK---TSSVYVH 256
            |   |.||.||:.| ...|..:|.|  :| :..|.|......||..|.||..|.:   .:|..:.
Zfish    71 G---LAGKYENDFD-KQNRFFIEKD--EG-SFNLSIANTEISDTATYYCVAYVYEFIFGNSTDLI 128

  Fly   257 VIIGEHPAAMQHNSSSNSNSFYCGICCMLLSIVSCCLQH---FYETGCG-------YLH--AAAA 309
            |..|:.....:|..|::.:.     .|.::| .||..:|   ::..|.|       |..  .:|.
Zfish   129 VNAGKLNIKSEHQRSASEDQ-----QCSVIS-QSCAEEHKVYWFRQGSGESSPGVIYTQNSRSAQ 187

  Fly   310 LAKSAGLGP---------PKRATLTTSETGISAAEVAAAAGAS--------------AAVASALA 351
            ..||:.|..         ||    |..:..|....|||.....              ..||.|||
Zfish   188 CEKSSDLNSTAHKCIYSLPK----TDEDPAIYYCAVAACGQILFGDVVTIPGFWTLWKTVALALA 248

  Fly   352 TCNML 356
            ..|.|
Zfish   249 ISNSL 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr1NP_001286645.1 Ig 59..154 CDD:299845 2/6 (33%)
IG_like 60..150 CDD:214653 1/2 (50%)
IG_like 163..257 CDD:214653 31/113 (27%)
Ig 174..244 CDD:143165 24/85 (28%)
nitr2bNP_571724.1 IG_like 28..129 CDD:214653 31/110 (28%)
IgV 29..129 CDD:143167 31/109 (28%)
Ig 149..232 CDD:299845 19/87 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1457433at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.