DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr1 and nitr1k

DIOPT Version :9

Sequence 1:NP_001286645.1 Gene:dpr1 / 2768858 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_938162.3 Gene:nitr1k / 60646 ZFINID:ZDB-GENE-001106-5 Length:328 Species:Danio rerio


Alignment Length:269 Identity:56/269 - (20%)
Similarity:90/269 - (33%) Gaps:92/269 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 FDVPRNLTVTVGQTG---FLHCRVERLGDKDVSWIRK----RDLHILTAGGTTYTSDQ------- 107
            |||.:...|.:.:.|   ...|:...|.....:|.::    :.|.|:    ::|.:.|       
Zfish    19 FDVVQEDNVKIVEAGKDVNFTCKFPELVQSINTWFKQTTDGKSLQIV----SSYLNQQPSWNHNF 79

  Fly   108 ----RFQVLRPDGSANWTLQIKYPQPRDSGVYECQINTEPKMSL----------SYTFNVVELKA 158
                ||.|...:|..|  |.|...:..||..|.|.|:....:.:          |.|.....|..
Zfish    80 VKTNRFNVANENGYFN--LTIFKTKSSDSATYYCVISAYQTIGMGSGTRLLVGDSATDRNSTLHQ 142

  Fly   159 EIFGPSDLMVKTGSDINLTCKIM----QGPHELGNIFWYKGSE-----MLDGKGENEIDSSMARI 214
            .:....|    .|..:||.|.|.    .|.|   :|:|:|.|.     :|..|||.         
Zfish   143 SLIDAVD----PGDAVNLQCSIFTESCAGDH---SIYWFKQSSGDSEGVLYTKGER--------- 191

  Fly   215 RVEDDWTDGLTSRLKIKRAMPGDTGNYTCVPTVAKTSSVYVHVIIGEHPAAMQHNSSSNSNSFYC 279
                   :|     :.|.:....|  .:||.::.|.:.                 |.|:|..:||
Zfish   192 -------NG-----RCKNSTESQT--QSCVYSLHKNNI-----------------SRSDSGIYYC 225

  Fly   280 GI--CCMLL 286
            .:  |..:|
Zfish   226 AVAACGQIL 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr1NP_001286645.1 Ig 59..154 CDD:299845 24/122 (20%)
IG_like 60..150 CDD:214653 22/117 (19%)
IG_like 163..257 CDD:214653 22/102 (22%)
Ig 174..244 CDD:143165 17/78 (22%)
nitr1kNP_938162.3 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1457433at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.