DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr1 and nitr1c

DIOPT Version :9

Sequence 1:NP_001286645.1 Gene:dpr1 / 2768858 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_938164.2 Gene:nitr1c / 60645 ZFINID:ZDB-GENE-001106-4 Length:328 Species:Danio rerio


Alignment Length:231 Identity:48/231 - (20%)
Similarity:78/231 - (33%) Gaps:68/231 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 FDVPRNLTVTVGQTGFLHCRVERLGDKDV------------SWIRKR-----------DLHILTA 98
            |||.:..||.:.:.|         ||.:.            :|.::.           ||.....
Zfish    19 FDVVQEDTVKIVEAG---------GDVNFTCIFPGHVPSTKAWFKQTTVGKYLQIVSLDLKKQLK 74

  Fly    99 GGTTYTSDQRFQVLRPDGSANWTLQIKYPQPRDSGVYECQINTEPKMSLSYTFNVVELKAEIFGP 163
            ..:::....||.|.:.|...|  |.|...:|.||..|.|.::....:.:.....::...|.....
Zfish    75 WNSSFEKTNRFNVTKVDDYFN--LTILKTKPSDSATYYCVVSAYETIGMGSATRLLVKDAATDRN 137

  Fly   164 SDL---MVKT---GSDINLTCKIM----QGPHELGNIFWYKGSE-----MLDGKGE------NEI 207
            :.|   :::|   |..:||.|.|.    .|.|   :::|:|.|.     :|..|||      |..
Zfish   138 TTLHQSLIETVDPGDSVNLQCSIFTESCAGDH---SVYWFKQSSGHPEGVLYTKGERNGRCKNNT 199

  Fly   208 DSSMARIRVEDDWTDGLTSRLKIKRAMPGDTGNYTC 243
            :|.          |......|........|:|.|.|
Zfish   200 ESQ----------TQSCVYSLHKNNISRSDSGIYYC 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr1NP_001286645.1 Ig 59..154 CDD:299845 21/117 (18%)
IG_like 60..150 CDD:214653 20/112 (18%)
IG_like 163..257 CDD:214653 24/102 (24%)
Ig 174..244 CDD:143165 21/85 (25%)
nitr1cNP_938164.2 V-set 23..129 CDD:311561 20/116 (17%)
V-set 147..244 CDD:311561 23/92 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1457433at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.