DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr1 and Robo1

DIOPT Version :9

Sequence 1:NP_001286645.1 Gene:dpr1 / 2768858 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster
Sequence 2:XP_017453545.1 Gene:Robo1 / 58946 RGDID:61941 Length:1687 Species:Rattus norvegicus


Alignment Length:289 Identity:72/289 - (24%)
Similarity:113/289 - (39%) Gaps:66/289 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 NAALA--PTPP----------TTSTTTISPSNLLPYF-------DF-----DVPRNLTVTVGQTG 71
            :|||.  ||.|          |.:.|:.:..|.|.|.       ||     :.|.:|.|:.|:..
  Rat    54 SAALVLFPTDPEDLERGNDNGTPAPTSDNDDNSLGYTGSRLRQEDFPPRIVEHPSDLIVSKGEPA 118

  Fly    72 FLHCRVERLGDKDVSWIRKRDLHILTAGGTTYTSD----QRFQVLRPDGSANWTLQIKYPQPR-- 130
            .|:|:.|......:.|.:         ||....:|    :..::|.|.||. :.|:|.:.:..  
  Rat   119 TLNCKAEGRPTPTIEWYK---------GGERVETDKDDPRSHRMLLPSGSL-FFLRIVHGRKSRP 173

  Fly   131 DSGVYECQINTEPKMSLSYTFNV-VELKAEIF--GPSDLMVKTGSDINLTCKIMQGPHELGNIFW 192
            |.|||.|........::|:..:: |.:..:.|  .|||:||..|....:.|:..:| |....|.|
  Rat   174 DEGVYICVARNYLGEAVSHNASLEVAILRDDFRQNPSDVMVAVGEPAVMECQPPRG-HPEPTISW 237

  Fly   193 YKGSEMLDGKGENEIDSSMARIRVEDDWTDGLTSRLKIKRAMPGDTGNYTCVPT--VAKTSSVYV 255
            .|....||.|.|        ||.:..       .:|.|......|.|.|.||.|  |.:..|...
  Rat   238 KKDGSPLDDKDE--------RITIRG-------GKLMITYTRKSDAGKYVCVGTNMVGERESEVA 287

  Fly   256 HVIIGEHPAAMQHNSS-----SNSNSFYC 279
            .:.:.|.|:.::..|:     .:|..|.|
  Rat   288 ELTVLERPSFVKRPSNLAVTVDDSAEFKC 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr1NP_001286645.1 Ig 59..154 CDD:299845 23/101 (23%)
IG_like 60..150 CDD:214653 23/95 (24%)
IG_like 163..257 CDD:214653 28/95 (29%)
Ig 174..244 CDD:143165 17/69 (25%)
Robo1XP_017453545.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.