DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr1 and DIP-delta

DIOPT Version :9

Sequence 1:NP_001286645.1 Gene:dpr1 / 2768858 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_001097508.2 Gene:DIP-delta / 5740816 FlyBaseID:FBgn0085420 Length:469 Species:Drosophila melanogaster


Alignment Length:223 Identity:62/223 - (27%)
Similarity:95/223 - (42%) Gaps:31/223 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 SNLLPYFDFDVPR------NLTVTVGQTGFLHCRVERLGDKDVSWIRKRDLHILTAGGTTYTSDQ 107
            :||:.:...|.||      |:||.||:...|.|.||.||...|:||......|||......:...
  Fly    33 TNLVTHVMMDEPRFAQPIPNVTVAVGRDANLPCVVEHLGGYKVAWIHIDRQMILTIHRHVISRIP 97

  Fly   108 RFQVLRPDGSANWTLQIKYPQPRDSGVYECQINTEPKMS-LSYTF-----NVVELKAEIFGPSDL 166
            |:.:...|.:  |.|.:......|.|.|.||:||.|.:| :.|..     |::::::.   ||.:
  Fly    98 RYSITYTDNT--WLLHVNQAHQDDRGYYMCQVNTNPMISQVGYLQVVVPPNILDIEST---PSSV 157

  Fly   167 MVKTGSDINLTCKIMQGPHELGNIFWYKGSEMLDGKGENEIDSSMARIRVEDDWTDGLTSRLKIK 231
            .|:...:||:||:....|  ...|.|.:..      ||........::.|.|.....||   |:.
  Fly   158 AVRENQNINMTCRADGFP--APKIIWRRED------GEEIAVEKKKKVLVYDADVLPLT---KVS 211

  Fly   232 RAMPGDTGNYTCVPTVAKTSSVYVHVII 259
            |   .:.|.|.|:.|.....||...:|:
  Fly   212 R---NEMGAYLCIATNGVPPSVSKRIIL 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr1NP_001286645.1 Ig 59..154 CDD:299845 34/106 (32%)
IG_like 60..150 CDD:214653 32/96 (33%)
IG_like 163..257 CDD:214653 24/93 (26%)
Ig 174..244 CDD:143165 17/69 (25%)
DIP-deltaNP_001097508.2 IG 51..143 CDD:214652 31/93 (33%)
Ig 145..238 CDD:416386 26/109 (24%)
Ig strand A 145..149 CDD:409353 1/3 (33%)
Ig strand A' 154..159 CDD:409353 2/4 (50%)
Ig strand B 165..172 CDD:409353 4/6 (67%)
Ig strand C 178..183 CDD:409353 2/4 (50%)
Ig strand C' 185..187 CDD:409353 0/7 (0%)
Ig strand D 195..199 CDD:409353 0/3 (0%)
Ig strand E 203..209 CDD:409353 2/8 (25%)
Ig strand F 216..223 CDD:409353 3/6 (50%)
Ig strand G 230..238 CDD:409353 2/7 (29%)
Ig 242..333 CDD:416386
Ig strand A' 250..253 CDD:409353
Ig strand B 259..266 CDD:409353
Ig strand C 272..277 CDD:409353
Ig strand C' 281..283 CDD:409353
Ig strand D 289..293 CDD:409353
Ig strand E 295..305 CDD:409353
Ig strand F 314..322 CDD:409353
Ig strand G 325..334 CDD:409353
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.