Sequence 1: | NP_001286645.1 | Gene: | dpr1 / 2768858 | FlyBaseID: | FBgn0040726 | Length: | 367 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001097508.2 | Gene: | DIP-delta / 5740816 | FlyBaseID: | FBgn0085420 | Length: | 469 | Species: | Drosophila melanogaster |
Alignment Length: | 223 | Identity: | 62/223 - (27%) |
---|---|---|---|
Similarity: | 95/223 - (42%) | Gaps: | 31/223 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 49 SNLLPYFDFDVPR------NLTVTVGQTGFLHCRVERLGDKDVSWIRKRDLHILTAGGTTYTSDQ 107
Fly 108 RFQVLRPDGSANWTLQIKYPQPRDSGVYECQINTEPKMS-LSYTF-----NVVELKAEIFGPSDL 166
Fly 167 MVKTGSDINLTCKIMQGPHELGNIFWYKGSEMLDGKGENEIDSSMARIRVEDDWTDGLTSRLKIK 231
Fly 232 RAMPGDTGNYTCVPTVAKTSSVYVHVII 259 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dpr1 | NP_001286645.1 | Ig | 59..154 | CDD:299845 | 34/106 (32%) |
IG_like | 60..150 | CDD:214653 | 32/96 (33%) | ||
IG_like | 163..257 | CDD:214653 | 24/93 (26%) | ||
Ig | 174..244 | CDD:143165 | 17/69 (25%) | ||
DIP-delta | NP_001097508.2 | IG | 51..143 | CDD:214652 | 31/93 (33%) |
Ig | 145..238 | CDD:416386 | 26/109 (24%) | ||
Ig strand A | 145..149 | CDD:409353 | 1/3 (33%) | ||
Ig strand A' | 154..159 | CDD:409353 | 2/4 (50%) | ||
Ig strand B | 165..172 | CDD:409353 | 4/6 (67%) | ||
Ig strand C | 178..183 | CDD:409353 | 2/4 (50%) | ||
Ig strand C' | 185..187 | CDD:409353 | 0/7 (0%) | ||
Ig strand D | 195..199 | CDD:409353 | 0/3 (0%) | ||
Ig strand E | 203..209 | CDD:409353 | 2/8 (25%) | ||
Ig strand F | 216..223 | CDD:409353 | 3/6 (50%) | ||
Ig strand G | 230..238 | CDD:409353 | 2/7 (29%) | ||
Ig | 242..333 | CDD:416386 | |||
Ig strand A' | 250..253 | CDD:409353 | |||
Ig strand B | 259..266 | CDD:409353 | |||
Ig strand C | 272..277 | CDD:409353 | |||
Ig strand C' | 281..283 | CDD:409353 | |||
Ig strand D | 289..293 | CDD:409353 | |||
Ig strand E | 295..305 | CDD:409353 | |||
Ig strand F | 314..322 | CDD:409353 | |||
Ig strand G | 325..334 | CDD:409353 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 46 | 1.000 | Domainoid score | I11916 |
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |