Sequence 1: | NP_001286645.1 | Gene: | dpr1 / 2768858 | FlyBaseID: | FBgn0040726 | Length: | 367 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001287571.1 | Gene: | CG34353 / 5740590 | FlyBaseID: | FBgn0085382 | Length: | 581 | Species: | Drosophila melanogaster |
Alignment Length: | 380 | Identity: | 80/380 - (21%) |
---|---|---|---|
Similarity: | 115/380 - (30%) | Gaps: | 163/380 - (42%) |
- Green bases have known domain annotations that are detailed below.
Fly 68 GQTGFLHCRVERLGDKDVSWIRKRDLHILTAGGTTYTSDQRFQVLRPDGSANWTLQIKYPQPRDS 132
Fly 133 GVYECQINTEPKMSLSYTFNVVELKAEIFGP---------SDLMVKTGSDINLTCKIMQGPHELG 188
Fly 189 NIFWYKGSEMLDGKGENEIDSSMARIRVEDD---------------------------------- 219
Fly 220 ----------------------------W----------------TDGLTSRLKIKRAMPGDTGN 240
Fly 241 YTCV-----------------PTVAKTSS---------------VYVHVIIGEHPAAMQH----- 268
Fly 269 -------NSSSNSNSFYCGICCMLLSIVSCCLQHFYETGCGYLHAAAALAKSAGL 316 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dpr1 | NP_001286645.1 | Ig | 59..154 | CDD:299845 | 29/85 (34%) |
IG_like | 60..150 | CDD:214653 | 28/81 (35%) | ||
IG_like | 163..257 | CDD:214653 | 33/212 (16%) | ||
Ig | 174..244 | CDD:143165 | 20/147 (14%) | ||
CG34353 | NP_001287571.1 | IG_like | 100..180 | CDD:214653 | 31/93 (33%) |
Ig | 103..177 | CDD:143165 | 27/87 (31%) | ||
IG_like | 191..269 | CDD:214653 | 15/80 (19%) | ||
IGc2 | 198..258 | CDD:197706 | 12/62 (19%) | ||
I-set | 273..360 | CDD:254352 | 12/86 (14%) | ||
Ig | 290..359 | CDD:143165 | 12/68 (18%) | ||
FN3 | <466..524 | CDD:238020 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |