DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr1 and CG34353

DIOPT Version :9

Sequence 1:NP_001286645.1 Gene:dpr1 / 2768858 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_001287571.1 Gene:CG34353 / 5740590 FlyBaseID:FBgn0085382 Length:581 Species:Drosophila melanogaster


Alignment Length:380 Identity:80/380 - (21%)
Similarity:115/380 - (30%) Gaps:163/380 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 GQTGFLHCRVERLGDKDVSWIRKRDLHILTAGGTTYTSDQRFQVLRPDGSANWTLQIKYPQPRDS 132
            |:|..|.|.|.......|:|  ||.:.|||||....|.|.|.:::.     .:.|||:...|.|:
  Fly   100 GETIVLPCEVANTDTYVVAW--KRGIAILTAGSVKVTPDPRVRLVN-----GFNLQIRDALPTDA 157

  Fly   133 GVYECQINTEPKMSLSYTFNVVELKAEIFGP---------SDLMVKTGSDINLTCKIMQGPHELG 188
            |.|.|||.|.....:::|       .||..|         ..|.||.||.:.:.|.....|  :.
  Fly   158 GDYICQIATMDPREITHT-------VEILVPPRIHHISTGGHLQVKKGSSVRIECSATGNP--MP 213

  Fly   189 NIFWYKGSEMLDGKGENEIDSSMARIRVEDD---------------------------------- 219
            |:.|.:.:.:|. .||.::.|.:..|...|.                                  
  Fly   214 NVTWSRKNNILP-NGEEKLHSHVLSIENVDRHKGGVYICTANNRVGQPASSQVVLHVLFSPEISV 277

  Fly   220 ----------------------------W----------------TDGLTSRLKIKRAMPGDTGN 240
                                        |                |.|....|.|::..|.|.||
  Fly   278 ERPVVFSGEGHEATLVCIVHGETQPEVIWFKDTMQLDTTERHIMETRGSRHTLIIRKVHPQDFGN 342

  Fly   241 YTCV-----------------PTVAKTSS---------------VYVHVIIGEHPAAMQH----- 268
            |:||                 |.||..:|               |..|..|.|:..:.:.     
  Fly   343 YSCVAENQLGKARKTLQLSGKPNVAVFNSPPISQYKDRYNISWAVDSHSPIEEYKLSFRKLPQGH 407

  Fly   269 -------NSSSNSNSFYCGICCMLLSIVSCCLQHFYETGCGYLHAAAALAKSAGL 316
                   :|||:|:|            :|......|.:|   |||....:...||
  Fly   408 EVVGNAIDSSSSSSS------------MSSSSSQMYGSG---LHAHRIGSNMGGL 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr1NP_001286645.1 Ig 59..154 CDD:299845 29/85 (34%)
IG_like 60..150 CDD:214653 28/81 (35%)
IG_like 163..257 CDD:214653 33/212 (16%)
Ig 174..244 CDD:143165 20/147 (14%)
CG34353NP_001287571.1 IG_like 100..180 CDD:214653 31/93 (33%)
Ig 103..177 CDD:143165 27/87 (31%)
IG_like 191..269 CDD:214653 15/80 (19%)
IGc2 198..258 CDD:197706 12/62 (19%)
I-set 273..360 CDD:254352 12/86 (14%)
Ig 290..359 CDD:143165 12/68 (18%)
FN3 <466..524 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.