DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment dpr1 and obscnb

DIOPT Version :9

Sequence 1:	NP_001286645.1	Gene:	dpr1 / 2768858	FlyBaseID:	FBgn0040726	Length:	367	Species:	Drosophila melanogaster
Sequence 2:	XP_021326058.1	Gene:	obscnb / 572412	ZFINID:	ZDB-GENE-070119-5	Length:	6781	Species:	Danio rerio

Alignment Length:	191	Identity:	47/191 - (24%)
Similarity:	74/191 - (38%)	Gaps:	43/191 - (22%)

- Green bases have known domain annotations that are detailed below.

  Fly    61 RNLTVTVGQTGFLHCRVERLGDKDVSW------IRKRDLHILTAGGTTYTSDQRFQVLRPDGSAN 119
            :::||..|:.....|.|.:.|..:|.|      ::..||:.::..|..:
Zfish  4101 KDVTVITGEDAIFQCEVSQKGVTNVEWWLGSNHLQNNDLNQISCQGREH---------------- 4149

  Fly   120 WTLQIKYPQPRDSGVYECQINTEPKMSLSYTFNVVELKAEIF--GPSDLMVKTGSDINLTCKIMQ 182
             :|.:|...|.|||  :......|..|::|.. |.|....:|  .|.|:..|.|..:.|:|  |.
Zfish  4150 -SLVLKMVTPDDSG--DVAFVVGPMKSVAYLM-VQEKPKVVFLEKPLDITAKEGQTVTLSC--MT 4208

  Fly   183 GPHELGNIFWYKGSEMLDGKGENEIDSSMARIRVEDDWTDGLTSRLKIKRAMPGDTGNYTC 243
            ...|.. :.|||..||:...|...:            :.|....:|:|.|...||.|.|||
Zfish  4209 SDPEAA-VAWYKDEEMIKAGGRYLL------------YKDRAVHQLRILRVEEGDAGLYTC 4256

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
dpr1	NP_001286645.1	Ig	59..154	CDD:299845	20/98 (20%)
		IG_like	60..150	CDD:214653	19/94 (20%)
		IG_like	163..257	CDD:214653	24/81 (30%)
		Ig	174..244	CDD:143165	20/70 (29%)
obscnb	XP_021326058.1	I-set	10..99	CDD:254352
		I-set	110..199	CDD:254352
		I-set	282..362	CDD:333254
		I-set	369..452	CDD:333254
		I-set	459..>523	CDD:333254
		FN3	547..634	CDD:238020
		Ig	762..809	CDD:319273
		IG	836..901	CDD:214652
		I-set	928..997	CDD:333254
		I-set	1020..1089	CDD:333254
		I-set	1112..1181	CDD:333254
		I-set	1204..1273	CDD:333254
		I-set	1296..1365	CDD:333254
		Ig	1401..1469	CDD:319273
		I-set	1483..1552	CDD:333254
		Ig	1585..1644	CDD:319273
		Ig	1689..1732	CDD:319273
		I-set	1750..1833	CDD:333254
		I-set	1840..1923	CDD:254352
		I-set	1930..1999	CDD:333254
		I-set	2018..2091	CDD:333254
		I-set	2107..2190	CDD:333254
		I-set	2196..2279	CDD:333254
		I-set	2285..2368	CDD:333254
		I-set	2374..2458	CDD:333254
		I-set	2464..2547	CDD:333254
		I-set	2553..>2620	CDD:333254
		I-set	2643..2725	CDD:333254
		I-set	2732..2815	CDD:333254
		I-set	2820..2905	CDD:333254
		I-set	2912..2995	CDD:333254
		IG_like	3007..3084	CDD:214653
		I-set	3090..3160	CDD:333254
		I-set	3178..3260	CDD:333254
		I-set	3266..3349	CDD:333254
		IG_like	3389..>3452	CDD:214653
		I-set	3471..3541	CDD:333254
		I-set	3560..3630	CDD:333254
		I-set	3649..3719	CDD:333254
		I-set	3739..3808	CDD:333254
		I-set	3828..3910	CDD:333254
		IG	3926..4000	CDD:214652
		I-set	4007..4090	CDD:254352
		I-set	4095..>4162	CDD:333254	15/77 (19%)
		I-set	4186..4269	CDD:254352	25/86 (29%)
		I-set	4275..4358	CDD:333254
		IG	4370..4449	CDD:214652
		IG_like	4461..4538	CDD:214653
		I-set	4636..>4700	CDD:333254
		FN3	4725..4818	CDD:238020
		I-set	4825..4906	CDD:333254
		IQ	5065..5087	CDD:197470
		I-set	5104..5177	CDD:254352
		I-set	5331..5421	CDD:254352
		I-set	5469..5559	CDD:254352
		I-set	5583..5678	CDD:333254
		SH3_Obscurin_like	5807..5869	CDD:212958
		RhoGEF	5899..6075	CDD:321997
		PH_Obscurin	6084..6208	CDD:270059
		I-set	6216..6308	CDD:254352
		I-set	6310..6399	CDD:333254
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.910