Sequence 1: | NP_001286645.1 | Gene: | dpr1 / 2768858 | FlyBaseID: | FBgn0040726 | Length: | 367 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_009293693.1 | Gene: | igsf9bb / 569554 | ZFINID: | ZDB-GENE-091112-15 | Length: | 1439 | Species: | Danio rerio |
Alignment Length: | 203 | Identity: | 45/203 - (22%) |
---|---|---|---|
Similarity: | 74/203 - (36%) | Gaps: | 41/203 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 53 PYFDFDVPRNLTVTVGQTGFLHCRVERL-GDKDVSWIRKRDLHILTAGGTTYTSDQRFQV-LRPD 115
Fly 116 GSANWTLQIKYPQPRDSGVYEC----QINTEPK----MSLSYTFNVVELKAEIFGPSDLMVKTGS 172
Fly 173 DINLTCKIMQGPHELGNIFWYKGSEMLDGKGENEIDSSMARIRVEDDWTDGLTSRLKIKRAMPGD 237
Fly 238 TGNYTCVP 245 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dpr1 | NP_001286645.1 | Ig | 59..154 | CDD:299845 | 25/104 (24%) |
IG_like | 60..150 | CDD:214653 | 24/99 (24%) | ||
IG_like | 163..257 | CDD:214653 | 17/83 (20%) | ||
Ig | 174..244 | CDD:143165 | 11/69 (16%) | ||
igsf9bb | XP_009293693.1 | IG_like | 30..113 | CDD:214653 | |
Ig | 41..113 | CDD:143165 | |||
IG_like | 144..223 | CDD:214653 | |||
IGc2 | 151..208 | CDD:197706 | |||
I-set | 227..319 | CDD:254352 | 25/102 (25%) | ||
Ig | <263..319 | CDD:299845 | 14/66 (21%) | ||
Ig_2 | 326..414 | CDD:290606 | 17/92 (18%) | ||
IG_like | 329..403 | CDD:214653 | 17/83 (20%) | ||
IG_like | 424..504 | CDD:214653 | |||
Ig | 440..504 | CDD:299845 | |||
FN3 | 509..604 | CDD:238020 | |||
FN3 | 620..704 | CDD:238020 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |