DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr1 and dscama

DIOPT Version :9

Sequence 1:NP_001286645.1 Gene:dpr1 / 2768858 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster
Sequence 2:XP_021334866.1 Gene:dscama / 568643 ZFINID:ZDB-GENE-050310-7 Length:2025 Species:Danio rerio


Alignment Length:208 Identity:53/208 - (25%)
Similarity:83/208 - (39%) Gaps:49/208 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 VGQTGF--LHCRVERLGDKDVSWI----------RKRDLHILTAGGTTYTSDQRFQVLRPDGSAN 119
            ||...|  |.|.|:......::|.          |.|.:|.:||.|...:               
Zfish   419 VGPNDFVSLTCHVKGTPQPAITWTLDDEVVAKDSRHRIVHSITAEGNVVS--------------- 468

  Fly   120 WTLQIKYPQPRDSGVYECQINTEPKMSLSYTFNV-VELKAEIFGPSDLMVKTGSDINLTCKIMQG 183
             .|.|.:.|.||||||.|..|.... ::||...: |...|:|....:|....|.|:.:.|.::..
Zfish   469 -YLNISHIQVRDSGVYRCTCNNSAG-TVSYQARINV
RGSADIRPMKNLTAIAGWDMYIHCHVIGY 531

  Fly   184 PHELGNIFWYKGSEMLDGKGENEIDSSMARIRVEDDWTDGLTSRLKIKRAMPGDTGNYTC----V 244
            |:.  :|.|:|.|.:|....         |.|..::  :|....|.:::.:  |.|.|:|    .
Zfish   532 PYY--SIKWFKNSNLLPFND---------RQRAFEN--NGTLKLLNVQKEL--DEGEYSCHVQVQ 581

  Fly   245 PTVAKTSSVYVHV 257
            |.:.|..||:|.|
Zfish   582 PQLFKNQSVHVTV 594

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr1NP_001286645.1 Ig 59..154 CDD:299845 26/99 (26%)
IG_like 60..150 CDD:214653 25/94 (27%)
IG_like 163..257 CDD:214653 23/97 (24%)
Ig 174..244 CDD:143165 15/73 (21%)
dscamaXP_021334866.1 Ig 124..217 CDD:325142
I-set 236..311 CDD:254352
IG_like 321..402 CDD:214653
I-set 408..502 CDD:333254 26/99 (26%)
IGc2 524..579 CDD:197706 15/69 (22%)
Ig 614..679 CDD:319273
Ig_DSCAM 708..787 CDD:143211
Ig 805..898 CDD:325142
FN3 894..988 CDD:238020
FN3 995..1092 CDD:238020
fn3 1100..1186 CDD:306538
fn3 1199..1282 CDD:306538
Ig 1312..1377 CDD:319273
fn3 1405..1471 CDD:306538
FN3 1492..1563 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.