DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr1 and igsf9ba

DIOPT Version :9

Sequence 1:NP_001286645.1 Gene:dpr1 / 2768858 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster
Sequence 2:XP_009289969.2 Gene:igsf9ba / 567389 ZFINID:ZDB-GENE-060503-729 Length:1475 Species:Danio rerio


Alignment Length:263 Identity:61/263 - (23%)
Similarity:103/263 - (39%) Gaps:61/263 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 GWLLLLSMVLLRGYNA--------ALAPTPPTTSTTTISPSNLLPYFDFDVPRNLTVTVGQTGFL 73
            ||.....::|.:.|:.        .....|||.|.|.              |:.:....|.:..|
Zfish   109 GWYECRVLMLEQQYDTFHNGSWVHLTVNAPPTFSDTP--------------PQYVEAREGGSITL 159

  Fly    74 HCRVERLGDKDVSWIRKRDLHILTAGGTTYTSDQRFQVLRPDGSANWTLQIKYPQPRDSGVYECQ 138
            .|.........|:|:|:         |...||.:::.|  .|||    |.::.....|.|.|.|:
Zfish   160 TCTAFGNPKPVVTWLRE---------GDQLTSTRKYTV--SDGS----LTVQAITREDRGAYSCR 209

  Fly   139 INTEPKMSLSYTFNVVELKAEIF-GPSDLMVKTGSDINLTCKIMQGPHELGNI--FWYKGSEMLD 200
            .:::...:|..|..:|:....|. .|.::.|....:...||:....|   ||:  .||...:.:.
Zfish   210 AHSDQGEALHTTRLLVQGPPYIVTPPENITVNISQNAQFTCQAEAYP---GNLTYTWYWEEDNVY 271

  Fly   201 GKGENEIDSSMARIRVEDDWTDGLTSRLKIKRAMPGDTGNYTCVPT----VAKTSSVYVHVIIGE 261
            .|.:.::     |:|:..|.|      |.|.|..|.|.|.|||.|:    ::.::|.|:.|   :
Zfish   272 FKNDLKL-----RVRIFIDGT------LIIYRVKPEDAGKYTCSPSNSLGISPSASAYLTV---Q 322

  Fly   262 HPA 264
            :||
Zfish   323 YPA 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr1NP_001286645.1 Ig 59..154 CDD:299845 21/94 (22%)
IG_like 60..150 CDD:214653 20/89 (22%)
IG_like 163..257 CDD:214653 26/99 (26%)
Ig 174..244 CDD:143165 20/71 (28%)
igsf9baXP_009289969.2 IG 30..115 CDD:214652 2/5 (40%)
I-set 139..225 CDD:254352 25/114 (22%)
I-set 229..321 CDD:333254 27/105 (26%)
Ig 345..415 CDD:325142
Ig 438..503 CDD:319273
FN3 511..606 CDD:238020
FN3 622..706 CDD:238020
Atrophin-1 <924..1361 CDD:331285
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.