Sequence 1: | NP_001286645.1 | Gene: | dpr1 / 2768858 | FlyBaseID: | FBgn0040726 | Length: | 367 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_689255.3 | Gene: | robo4 / 560765 | ZFINID: | ZDB-GENE-020809-1 | Length: | 1134 | Species: | Danio rerio |
Alignment Length: | 197 | Identity: | 45/197 - (22%) |
---|---|---|---|
Similarity: | 75/197 - (38%) | Gaps: | 41/197 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 60 PRNLTVTVGQTGFLHCRVERLGDKDVSWIRKRDLHILTAGGTTYTSD----QRFQVLRPDGSANW 120
Fly 121 TLQIKYPQPRDSG-----VYECQINTE--PKMSLSYTFNVVELKAEI-FGPSDLMVKTGSDINLT 177
Fly 178 CKIMQGPHELGNIFWYKGSEMLDGKGENEIDSSMARIRVEDDWTDGLTSRLKIKRAMPGDTGNYT 242
Fly 243 CV 244 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dpr1 | NP_001286645.1 | Ig | 59..154 | CDD:299845 | 23/104 (22%) |
IG_like | 60..150 | CDD:214653 | 23/100 (23%) | ||
IG_like | 163..257 | CDD:214653 | 21/82 (26%) | ||
Ig | 174..244 | CDD:143165 | 15/69 (22%) | ||
robo4 | XP_689255.3 | Ig1_Robo | 70..169 | CDD:143317 | 23/104 (22%) |
I-set | 71..168 | CDD:254352 | 23/103 (22%) | ||
I-set | 175..261 | CDD:254352 | 21/86 (24%) | ||
Ig2_Robo | 177..261 | CDD:143201 | 21/84 (25%) | ||
I-set | 265..350 | CDD:254352 | |||
Ig | 282..350 | CDD:299845 | |||
FN3 | 373..448 | CDD:214495 | |||
FN3 | 472..560 | CDD:238020 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |