DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr1 and robo4

DIOPT Version :9

Sequence 1:NP_001286645.1 Gene:dpr1 / 2768858 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster
Sequence 2:XP_689255.3 Gene:robo4 / 560765 ZFINID:ZDB-GENE-020809-1 Length:1134 Species:Danio rerio


Alignment Length:197 Identity:45/197 - (22%)
Similarity:75/197 - (38%) Gaps:41/197 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 PRNLTVTVGQTGFLHCRVERLGDKDVSWIRKRDLHILTAGGTTYTSD----QRFQVLRPDGSANW 120
            |.::.|.||....|.||.|...:..:.|:|         .|....:|    |...::.||||..:
Zfish    77 PSDVVVRVGSPATLSCRAEGNPEPTIQWLR---------NGQPLDTDKMDAQSQPIVLPDGSLFF 132

  Fly   121 TLQIKYPQPRDSG-----VYECQINTE--PKMSLSYTFNVVELKAEI-FGPSDLMVKTGSDINLT 177
            ...:    |...|     ||.|..:..  ...|.:.:.::..|:.:. ..|||:.|..|....:.
Zfish   133 FSVV----PGRKGQSHEAVYACIAHNSIGNATSRNASLHIA
ALREDFRVQPSDVEVAIGEMATIN 193

  Fly   178 CKIMQGPHELGNIFWYKGSEMLDGKGENEIDSSMARIRVEDDWTDGLTSRLKIKRAMPGDTGNYT 242
            |....| |...|:.|.|...:::...|:              :|: |..:|.|..|...|:|.|:
Zfish   194 CSPPVG-HPEPNVTWRKDGILINSSNEH--------------YTE-LKGKLIIAPAQKNDSGVYS 242

  Fly   243 CV 244
            |:
Zfish   243 CI 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr1NP_001286645.1 Ig 59..154 CDD:299845 23/104 (22%)
IG_like 60..150 CDD:214653 23/100 (23%)
IG_like 163..257 CDD:214653 21/82 (26%)
Ig 174..244 CDD:143165 15/69 (22%)
robo4XP_689255.3 Ig1_Robo 70..169 CDD:143317 23/104 (22%)
I-set 71..168 CDD:254352 23/103 (22%)
I-set 175..261 CDD:254352 21/86 (24%)
Ig2_Robo 177..261 CDD:143201 21/84 (25%)
I-set 265..350 CDD:254352
Ig 282..350 CDD:299845
FN3 373..448 CDD:214495
FN3 472..560 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.