DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr1 and nitr12

DIOPT Version :9

Sequence 1:NP_001286645.1 Gene:dpr1 / 2768858 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_001020667.1 Gene:nitr12 / 557932 ZFINID:ZDB-GENE-041001-1 Length:318 Species:Danio rerio


Alignment Length:305 Identity:59/305 - (19%)
Similarity:113/305 - (37%) Gaps:85/305 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LIGWLLLLSMVLLRGYNAALAPTPPTTSTTTISPSNLLPYFDFDVPRNLTVTVGQTGFLHCRVER 79
            :|.:||:..::...|::.|            :....:|..|          |.|||..|.|.:..
Zfish     1 MIAFLLVYFLLFRTGFSGA------------VVQKKVLESF----------TAGQTVTLECLISV 43

  Fly    80 LGDKDVSWIRK------RDLHILTAGGTT------YTSDQRFQVLRPDGSANWTLQIKYPQPRDS 132
            ..:...||.::      ..:..|.|..:|      :.::.|..|.:...:  :.|.||..:|.|:
Zfish    44 NLENYFSWFKQTLGEAPTCIVSLYAESSTPVFYGEFKNNHRMSVQKEKNT--FVLNIKEAKPSDA 106

  Fly   133 GVYEC------QINTEPKMSLSY---TFNVVELKAEIFGPS-----DLMVKTGSDINLTCKIM-Q 182
            |:|.|      .|.....:.|:|   :.....:|..:.||:     :.....|..:||.|.:: :
Zfish   107 GIYYCGARDYDLITFSNGLFLNYKDASTKQHHIKQFLSGPNLGTEHEPEFNPGDSVNLHCSVLTE 171

  Fly   183 GPHELGNIFWYK--------GSEMLDG--------KGENEIDSSMARIRVED-DWTD-------- 222
            ...|...|:|::        |....||        :.|.::.|.:..:..:: :.||        
Zfish   172 RCEENHTIYWFRHEFGDAHPGLIYKDGNTTDQCEKRSEKDVQSCIYNLPKKNLNLTDAGVYYCAV 236

  Fly   223 --------GLTSRLKIKRAMPGDTGNYTCVPTVAKTSSVYVHVII 259
                    |..||:.| ||....:.....||.:|.|:.:.:.:|:
Zfish   237 ATCGEILFGNGSRINI-RASSKFSWTDVKVPVLASTNILCLVIIV 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr1NP_001286645.1 Ig 59..154 CDD:299845 24/115 (21%)
IG_like 60..150 CDD:214653 24/110 (22%)
IG_like 163..257 CDD:214653 25/132 (19%)
Ig 174..244 CDD:143165 19/103 (18%)
nitr12NP_001020667.1 IgV 28..124 CDD:143167 23/107 (21%)
IG_like 30..123 CDD:214653 22/94 (23%)
V-set 150..253 CDD:284989 18/103 (17%)
IG_like 155..236 CDD:214653 14/80 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1457433at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.