| Sequence 1: | NP_001286645.1 | Gene: | dpr1 / 2768858 | FlyBaseID: | FBgn0040726 | Length: | 367 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_005155702.1 | Gene: | igsf9a / 557459 | ZFINID: | ZDB-GENE-060503-288 | Length: | 1619 | Species: | Danio rerio |
| Alignment Length: | 260 | Identity: | 60/260 - (23%) |
|---|---|---|---|
| Similarity: | 101/260 - (38%) | Gaps: | 54/260 - (20%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 17 GWLLLLSMVLLRGYNAALAPTPPTTSTTTISPS------NLLPYFDFDVPRNLTVTVGQTGFLHC 75
Fly 76 RVERLGDKDVSWIRKRDLHILTAGGTTYTSDQRFQVLRPDGSANWTLQIKYPQPRD-SGVYECQI 139
Fly 140 -NTEPKMSLSYTFNVVELKAEIFGPSDLMVKTGSDINLTCKIMQGPHELGNIFWYKGSEMLDGKG 203
Fly 204 ENEIDSSMARIRVEDDWTDGLTSRLKIKRAMPGDTGNYTCVPT----VAKTSSVYVHVIIGEHPA 264
Fly 265 264 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| dpr1 | NP_001286645.1 | Ig | 59..154 | CDD:299845 | 16/96 (17%) |
| IG_like | 60..150 | CDD:214653 | 16/91 (18%) | ||
| IG_like | 163..257 | CDD:214653 | 30/97 (31%) | ||
| Ig | 174..244 | CDD:143165 | 21/69 (30%) | ||
| igsf9a | XP_005155702.1 | IG_like | 27..110 | CDD:214653 | 3/15 (20%) |
| Ig | 35..111 | CDD:299845 | 3/16 (19%) | ||
| I-set | 140..221 | CDD:254352 | 16/96 (17%) | ||
| IGc2 | 151..212 | CDD:197706 | 12/76 (16%) | ||
| Ig | 233..318 | CDD:299845 | 30/99 (30%) | ||
| I-set | 233..318 | CDD:254352 | 30/99 (30%) | ||
| Ig | <349..402 | CDD:299845 | |||
| IG_like | 423..502 | CDD:214653 | |||
| Ig | 435..498 | CDD:143165 | |||
| FN3 | 507..602 | CDD:238020 | |||
| fn3 | 614..696 | CDD:278470 | |||
| PHA02666 | 1105..>1312 | CDD:222914 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||