DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr1 and LOC556776

DIOPT Version :9

Sequence 1:NP_001286645.1 Gene:dpr1 / 2768858 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster
Sequence 2:XP_021328638.1 Gene:LOC556776 / 556776 -ID:- Length:662 Species:Danio rerio


Alignment Length:287 Identity:54/287 - (18%)
Similarity:101/287 - (35%) Gaps:90/287 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 LTVTVGQTGFLHCRVER---LGDKDVSWIRKRD----LHILTAGGTTYTSDQRFQVLRPD----- 115
            |:..:|.:..|.|.|:.   :.|.:|.| |:.|    :|:...|      :.|.:|.:.|     
Zfish    28 LSAPLGSSVVLPCYVDEALPVEDLEVEW-RRADSETLVHLYQDG------ESRAEVQQQDYHDRA 85

  Fly   116 -------GSANWTLQIKYPQPRDSGVYECQINTEPKMSLSYTFNVVELKAEIFGPSDLMVKTGS- 172
                   ...|::|::.....:|.|.|.|:::::....        |..|:|...::.::.:|| 
Zfish    86 HFFTEEIQHGNFSLRLDNLTAQDEGEYRCRVHSQQDSG--------ETVAQIKVSNERLLVSGSN 142

  Fly   173 ---------DINLTCKIMQ--GPHELGNIFWYKGSE------MLDGKGENEIDSSMARIRVEDDW 220
                     |:.|.|.:..  .|..:..:.|.|..|      :|....|...|||..:.|...::
Zfish   143 RPASAYVGEDVTLNCSVDSHITPEHIEEVSWLKTDEDGDFLVLLYQNKETLPDSSNEQFRGRVEF 207

  Fly   221 TDGLTSR----LKIKRAMPGDTGNYTCVPTVAKTSSVYVHVIIGE-----------------HPA 264
            ......:    |::|.....|.|.|.|            .|..|:                 |.|
Zfish   208 FTAEIPKGNFSLRLKSVRTEDKGVYMC------------QVFAGDLSANATVELERLGFSSLHIA 260

  Fly   265 AMQHNSSSNSNSFYCGICCMLLSIVSC 291
            .:..:.::.|     |...:|.|::.|
Zfish   261 VLFFSVAAGS-----GAVLLLCSLIYC 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr1NP_001286645.1 Ig 59..154 CDD:299845 21/109 (19%)
IG_like 60..150 CDD:214653 21/105 (20%)
IG_like 163..257 CDD:214653 21/115 (18%)
Ig 174..244 CDD:143165 17/81 (21%)
LOC556776XP_021328638.1 Ig 33..132 CDD:325142 23/113 (20%)
Ig 150..249 CDD:325142 21/110 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.