DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr1 and KIRREL1

DIOPT Version :9

Sequence 1:NP_001286645.1 Gene:dpr1 / 2768858 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster
Sequence 2:XP_005245362.1 Gene:KIRREL1 / 55243 HGNCID:15734 Length:773 Species:Homo sapiens


Alignment Length:271 Identity:62/271 - (22%)
Similarity:95/271 - (35%) Gaps:74/271 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LIGWLLLLSMVLLRGYNAALAPTPPTTSTTTISPSNLLPYFDFDVPRNLTVTVGQTGFLHCRVER 79
            |:.|:|.||....:|            :.|..|..          |.:.||..||...|.|.:..
Human     4 LLVWILTLSDTFSQG------------TQTRFSQE----------PADQTVVAGQRAVLPCVLLN 46

  Fly    80 LGDKDVSWIRKRDLHILTAG-GTTYTSDQRFQVLRPDGSANWTLQIKYPQPRDSGVYECQINTEP 143
            ... .|.|.:..    |..| |....:..|::|:....:..:.|:|...:..|...||||. ||.
Human    47 YSG-IVQWTKDG----LALGMGQGLKAWPRYRVVGSADAGQYNLEITDAELSDDASYECQA-TEA 105

  Fly   144 KM---SLSYTFNVVELKAEIFGPSDLMVKTGSDINLTCKIMQGPHELGNIFWYK----------G 195
            .:   ....|..:......|.|...::::.|:..||||:.... .....|.|::          .
Human   106 ALRSRRAKLTVLIPPEDTRIDGGPVILLQAGTPHNLTCRAFNA-KPAATIIWFRDGTQQEGAVAS 169

  Fly   196 SEML-DGKGENEIDSSMARIRVEDDWTDGLTSRLKIKRAMPGDTGNYTC------VPTVAKTS-S 252
            :|:| |||.|..:  |...|...|         |.|.|.       :||      :|:..:|| .
Human   170 TELLKDGKRETTV--SQLLINPTD---------LDIGRV-------FTCRSMNEAIPSGKETSIE 216

  Fly   253 VYVHVIIGEHP 263
            :.||     ||
Human   217 LDVH-----HP 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr1NP_001286645.1 Ig 59..154 CDD:299845 24/98 (24%)
IG_like 60..150 CDD:214653 23/93 (25%)
IG_like 163..257 CDD:214653 25/111 (23%)
Ig 174..244 CDD:143165 20/86 (23%)
KIRREL1XP_005245362.1 I-set 22..116 CDD:254352 24/109 (22%)
Ig 25..116 CDD:299845 23/106 (22%)
Ig2_KIRREL3-like 138..219 CDD:143236 23/99 (23%)
I-set 223..304 CDD:254352 62/271 (23%)
Ig_2 227..305 CDD:290606
Ig_2 311..405 CDD:290606
IG_like 314..405 CDD:214653
Ig5_KIRREL3 407..504 CDD:143306
IG_like 416..504 CDD:214653
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.