DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr1 and iglon5

DIOPT Version :9

Sequence 1:NP_001286645.1 Gene:dpr1 / 2768858 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_001017775.2 Gene:iglon5 / 550472 ZFINID:ZDB-GENE-050417-297 Length:332 Species:Danio rerio


Alignment Length:312 Identity:69/312 - (22%)
Similarity:121/312 - (38%) Gaps:77/312 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 VPRNLTVTVGQTGFLHCRVERLGDKDV---SWIRKRDLHILTAGGTTYTSDQRFQVLRPDGSANW 120
            :|.|:||..|::..|.|::    |::|   :|:.:.  :||..|...::.|.|.. |..:.::::
Zfish    32 LPDNITVLEGESVVLRCKI----DEEVTHKAWLNRS--NILFTGTDKWSLDSRVS-LENNNNSDF 89

  Fly   121 TLQIKYPQPRDSGVYECQINTEPKMSLSYTFNVVELKAEIFGPS-DLMVKTGSDINLTCKIMQGP 184
            :::|:.....|.|.|.|......|...::.:.:|::.|.|...| |..|..|.|:||.|..:..|
Zfish    90 SIRIERVMVADEGPYTCSFQARNKPRTAHVYLIVQVPARIVNISQDKSVNEGEDVNLFCLAVGRP 154

  Fly   185 HELGNIFWYKGSEMLDGKGENEIDSSMARIRVED---DWTDGL----TSRLKIK----------R 232
            ..  .|.|......|..:||....:.:.|.:.||   ...:|:    |.::|:.          :
Zfish   155 EP--TITWKDFKYGLLNEGEFLEITEIKRHQAEDFECITNNGVAPPDTRKVKVTVNYPPIITDVK 217

  Fly   233 AMP---GDTGNYTC----VPTVA----------------------KTSSVYVHVIIGEHPAAMQH 268
            .||   |.|....|    |||.:                      ||.|:.:...:.|     :|
Zfish   218 NMPAQVGKTAILRCEAMAVPTASFEWYRDDRRPVESDNTLKIKNEKTRSLLLFTNVTE-----KH 277

  Fly   269 NSSSN---SNSFYCGICCMLLSIVSCCLQHFYETGCGYLHAAAALAKSAGLG 317
            ..:..   ||........|||          :..|..|..||:...:.:|:|
Zfish   278 FGNYTCFASNRLGASNASMLL----------FRPGAVYGGAASLNGRLSGVG 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr1NP_001286645.1 Ig 59..154 CDD:299845 22/97 (23%)
IG_like 60..150 CDD:214653 22/92 (24%)
IG_like 163..257 CDD:214653 31/140 (22%)
Ig 174..244 CDD:143165 20/93 (22%)
iglon5NP_001017775.2 IG_like 33..123 CDD:214653 22/96 (23%)
Ig 35..123 CDD:299845 21/94 (22%)
Ig 125..>183 CDD:299845 17/59 (29%)
I-set 128..207 CDD:254352 21/80 (26%)
IG_like 217..298 CDD:214653 16/85 (19%)
ig 223..296 CDD:278476 13/77 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.