| Sequence 1: | NP_001286645.1 | Gene: | dpr1 / 2768858 | FlyBaseID: | FBgn0040726 | Length: | 367 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001138424.1 | Gene: | SDK2 / 54549 | HGNCID: | 19308 | Length: | 2172 | Species: | Homo sapiens |
| Alignment Length: | 330 | Identity: | 66/330 - (20%) |
|---|---|---|---|
| Similarity: | 107/330 - (32%) | Gaps: | 117/330 - (35%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 26 LLRG-YNAALAPTPPTTSTTTISPSNLLPYFDFDVPRNLTVTVGQTGFLHCRVERLGDKDVSWIR 89
Fly 90 KRDLHILTAGGTTYTSDQRFQVLRPDGSANWTLQIKYPQPRDSGVYEC-QINTEPKMSLSYTFNV 153
Fly 154 VELKAEIF-GPSDLMVKTGSDINLTCKIMQGPHELGNIFWYKGSEML------------------ 199
Fly 200 ------------------DGKGENEIDSSM---ARIRV----EDD-------------------- 219
Fly 220 -----W-TDGLT--------------SRLKIKRAMPGDTGNYTC-VPTVAKTSSVYVHVIIGEHP 263
Fly 264 AAMQH 268 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| dpr1 | NP_001286645.1 | Ig | 59..154 | CDD:299845 | 20/95 (21%) |
| IG_like | 60..150 | CDD:214653 | 20/90 (22%) | ||
| IG_like | 163..257 | CDD:214653 | 32/177 (18%) | ||
| Ig | 174..244 | CDD:143165 | 26/153 (17%) | ||
| SDK2 | NP_001138424.1 | Ig | 27..109 | CDD:299845 | |
| IG_like | 40..109 | CDD:214653 | |||
| I-set | 120..203 | CDD:254352 | |||
| Ig | 132..210 | CDD:299845 | |||
| IG_like | 222..304 | CDD:214653 | 3/7 (43%) | ||
| IGc2 | 233..286 | CDD:197706 | |||
| I-set | 308..397 | CDD:254352 | 22/100 (22%) | ||
| Ig | 326..394 | CDD:143165 | 18/79 (23%) | ||
| I-set | 402..492 | CDD:254352 | 16/91 (18%) | ||
| Ig | 416..492 | CDD:299845 | 11/77 (14%) | ||
| Ig | 502..586 | CDD:299845 | 16/83 (19%) | ||
| IG_like | 502..586 | CDD:214653 | 16/83 (19%) | ||
| FN3 | 590..681 | CDD:238020 | 3/6 (50%) | ||
| FN3 | 693..786 | CDD:238020 | |||
| FN3 | 794..890 | CDD:238020 | |||
| FN3 | 895..983 | CDD:238020 | |||
| FN3 | 993..1087 | CDD:238020 | |||
| FN3 | 1099..1194 | CDD:238020 | |||
| FN3 | 1201..1290 | CDD:238020 | |||
| FN3 | 1301..1394 | CDD:238020 | |||
| FN3 | 1400..1484 | CDD:238020 | |||
| FN3 | 1503..1616 | CDD:238020 | |||
| FN3 | 1626..1719 | CDD:238020 | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1707..1729 | ||||
| FN3 | 1724..1805 | CDD:238020 | |||
| FN3 | 1837..1916 | CDD:238020 | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 2039..2067 | ||||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 2098..2172 | ||||
| PDZ-binding. /evidence=ECO:0000250|UniProtKB:Q6V4S5 | 2166..2172 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.810 | |||||