DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr1 and NCAM2

DIOPT Version :9

Sequence 1:NP_001286645.1 Gene:dpr1 / 2768858 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster
Sequence 2:XP_011527877.1 Gene:NCAM2 / 4685 HGNCID:7657 Length:874 Species:Homo sapiens


Alignment Length:223 Identity:46/223 - (20%)
Similarity:82/223 - (36%) Gaps:37/223 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 GQTGFLHCRVERLGDKDVSWIRKRDLHILTAGGTTYTSDQRFQVLRPDGSANWTLQIKYPQPRDS 132
            |:...:.|||.......|||:...:       ..|..||.||.:|     ||..|||......|.
Human   154 GEDAEVVCRVSSSPAPAVSWLYHNE-------EVTTISDNRFAML-----ANNNLQILNINKSDE 206

  Fly   133 GVYECQINTEPKMSLSY--TFNVVELKAEIFGPS---DLMVKTGSDINLTCKIMQGPHELGNIFW 192
            |:|.|:...|.:..:.:  ...:|.:...|..|.   :...:.|.::..:|:....|...  |.|
Human   207 GIYRCEGRVEAR
GEIDFRDIIVIVNVPPAISMPQKSFNATAERGEEMTFSCRASGSPEPA--ISW 269

  Fly   193 YKGSEMLDGKGENEIDSSMARIRVEDDWTDGLTSRLKIKRAMPGDTGNYTCVPT---VAKTSSVY 254
            ::..::::   ||           |.....|..:.|.::..:..|.|.|.|..|   .......:
Human   270 FRNGKLIE---EN-----------EKYILKGSNTELTVRNIINSDGGPYVCRATNKAGEDEKQAF 320

  Fly   255 VHVIIGEHPAAMQHNSSSNSNSFYCGIC 282
            :.|.:..|...:: |.::..|.....:|
Human   321 LQVFVQPHIIQLK-NETTYENGQVTLVC 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr1NP_001286645.1 Ig 59..154 CDD:299845 23/87 (26%)
IG_like 60..150 CDD:214653 23/83 (28%)
IG_like 163..257 CDD:214653 16/99 (16%)
Ig 174..244 CDD:143165 12/69 (17%)
NCAM2XP_011527877.1 Ig1_NCAM-2 46..137 CDD:143274
I-set 47..136 CDD:254352
I-set 142..218 CDD:254352 23/75 (31%)
IGc2 153..214 CDD:197706 22/71 (31%)
Ig 233..326 CDD:299845 18/108 (17%)
I-set 240..323 CDD:254352 15/98 (15%)
Ig5_NCAM-2 325..422 CDD:143278 4/24 (17%)
IG_like 333..420 CDD:214653 3/16 (19%)
IG_like 438..515 CDD:214653
IGc2 439..507 CDD:197706
FN3 521..613 CDD:238020
fn3 619..703 CDD:278470
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.