DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr1 and NCAM1

DIOPT Version :9

Sequence 1:NP_001286645.1 Gene:dpr1 / 2768858 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_001229536.1 Gene:NCAM1 / 4684 HGNCID:7656 Length:884 Species:Homo sapiens


Alignment Length:238 Identity:57/238 - (23%)
Similarity:95/238 - (39%) Gaps:41/238 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 VPRNLTVTVGQTGFLHCRVE-RLGDKDVSWIRKRDLHILTAGGTTYT-SDQRFQVLRPDGSANWT 121
            ||....::||::.|..|:|. ...|||:||        .:..|...| :.||..|:..|.|:: |
Human    25 VPSQGEISVGESKFFLCQVAGDAKDKDISW--------FSPNGEKLTPNQQRISVVWNDDSSS-T 80

  Fly   122 LQIKYPQPRDSGVYECQINTEPKMSLSYTFNVVELKAEIF--GPSDLMVKTGSDINLTCKIMQG- 183
            |.|......|:|:|:|.:..|.......|.||...:..:|  .|:....:.|.|..:.|.::.. 
Human    81 LTIYNANIDDAGIYKCVVTGEDGSESEATVNVKIFQKLMFKNAPTPQEFREGEDAVIVCDVVSSL 145

  Fly   184 -PHELGNIFW-YKGSEMLDGKGENEIDSSMARIRVEDDWTDGLTSRLKIKRAMPGDTGNYTCVPT 246
             |    .|.| :||.:::..|....|..|              .:.|:|:.....|.|.|.|...
Human   146 PP----TIIWKHKGRDVILKKDVRFIVLS--------------NNYLQIRGIKKTDEGTYRCEGR 192

  Fly   247 VAKTSSVY---VHVIIGEHPA--AMQH--NSSSNSNSFYCGIC 282
            :.....:.   :.||:...|.  |.|:  |:::|.......:|
Human   193 ILARGEINFKDIQVIVNVPPTIQARQNIVNATANLGQSVTLVC 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr1NP_001286645.1 Ig 59..154 CDD:299845 29/96 (30%)
IG_like 60..150 CDD:214653 26/91 (29%)
IG_like 163..257 CDD:214653 18/99 (18%)
Ig 174..244 CDD:143165 14/72 (19%)
NCAM1NP_001229536.1 Ig1_NCAM-1 20..115 CDD:143273 30/98 (31%)
IG 124..190 CDD:214652 17/83 (20%)
Ig 211..307 CDD:325142 6/25 (24%)
Ig 306..438 CDD:325142
Ig_3 447..519 CDD:316449
FN3 534..631 CDD:238020
fn3 639..720 CDD:306538
Trypan_PARP <792..>864 CDD:330686
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.