DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr1 and negr1

DIOPT Version :9

Sequence 1:NP_001286645.1 Gene:dpr1 / 2768858 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster
Sequence 2:XP_009300786.1 Gene:negr1 / 445374 ZFINID:ZDB-GENE-040822-27 Length:360 Species:Danio rerio


Alignment Length:370 Identity:82/370 - (22%)
Similarity:122/370 - (32%) Gaps:111/370 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 WLIGWLLLLSMVLLRGYNAALAPTPPTTSTTTISPSNLLPYFDFDVPRNLTVTVGQTGFLHCRVE 78
            ||...:|.|...|     .:..|...|...||.|.|             :....|.|..|.|.:.
Zfish    16 WLTAIILSLCCFL-----PSCLPAGQTVDYTTSSES-------------VVSRQGDTALLRCYLL 62

  Fly    79 RLGDKDVSWIRKRDLHILTAGGTTYTSDQRFQVLRPDGSAN-WTLQIKYPQPRDSGVYECQINTE 142
            . |....:|:.:..  |:.||...::.|.|..::...|..: ::|||:.....|.|||.|.|.:|
Zfish    63 D-GISKGAWLNRSS--IIYAGNDKWSGDPRVSIVSNVGDKHEYSLQIQKVDVTDEGVYTCSIQSE 124

  Fly   143 PKMSLSYTFNVVELKAEIFG-PSDLMVKTGSDINLTCKIMQGPHELGNIFW---------YKGSE 197
            ..:.......:|::..:|:. .||:.|..||:::|.|.....|..  .|.|         |:..|
Zfish   125 RNLHPKLIQLIVKVPPKIYDISSDITVNEGSNVSLICAASGKPEP--KISWRHISPSARKYESGE 187

  Fly   198 MLDGKG-------------ENEI---DSSMARIRVE----------------------------- 217
            .|:..|             ||:|   |:...|:.|.                             
Zfish   188 YLNITGISRDQAGDYECGAENDIASPDTKTVRVTVNFPPAIHEMKSHGVRPGQVALLRCEAAAVP 252

  Fly   218 ---DDWTDG--------------LTSR--LKIKRAMPGDTGNYTCVPT---VAKTSSVYVHVIIG 260
               .:|..|              |:||  |.:|.......||||||..   ....:||.::.|| 
Zfish   253 SPVFEWYKGEKRINMGQGIVINNLSSRSVLTVKNMTQDRYGNYTCVAVNRLGTANASVPLNPII- 316

  Fly   261 EHPAAMQHNSSSNSNSFYCG--------ICCMLLSIVSCCLQHFY 297
             .|......||..||....|        :.|..|.:....|...|
Zfish   317 -EPTTTSAVSSPASNPAMYGSTGGAEVLLACWYLILALSSLVTVY 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr1NP_001286645.1 Ig 59..154 CDD:299845 22/95 (23%)
IG_like 60..150 CDD:214653 22/90 (24%)
IG_like 163..257 CDD:214653 35/169 (21%)
Ig 174..244 CDD:143165 26/142 (18%)
negr1XP_009300786.1 Ig 42..121 CDD:299845 23/94 (24%)
IG_like 44..136 CDD:214653 24/107 (22%)
I-set 140..222 CDD:254352 20/83 (24%)
IGc2 153..208 CDD:197706 11/56 (20%)
IG_like 236..312 CDD:214653 15/75 (20%)
IGc2 238..304 CDD:197706 13/65 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.