Sequence 1: | NP_001286645.1 | Gene: | dpr1 / 2768858 | FlyBaseID: | FBgn0040726 | Length: | 367 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_651649.1 | Gene: | DIP-gamma / 43417 | FlyBaseID: | FBgn0039617 | Length: | 413 | Species: | Drosophila melanogaster |
Alignment Length: | 206 | Identity: | 63/206 - (30%) |
---|---|---|---|
Similarity: | 88/206 - (42%) | Gaps: | 26/206 - (12%) |
- Green bases have known domain annotations that are detailed below.
Fly 62 NLTVTVGQTGFLHCRVERLGDKDVSWIRKRDLHILTAGGTTYTSDQRFQVLRPDGSANWTLQIKY 126
Fly 127 PQPRDSGVYECQINTEPKMSLSYTFNVVELKAEIF---GPSDLMVKTGSDINLTCKIMQGPHELG 188
Fly 189 NIFWYK--GSEMLDGK-GENEIDSSMARIRVEDDWTDGLTSRLKIKRAMPGDTGNYTCV------ 244
Fly 245 PTVAKTSSVYV 255 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dpr1 | NP_001286645.1 | Ig | 59..154 | CDD:299845 | 31/91 (34%) |
IG_like | 60..150 | CDD:214653 | 31/87 (36%) | ||
IG_like | 163..257 | CDD:214653 | 30/102 (29%) | ||
Ig | 174..244 | CDD:143165 | 19/72 (26%) | ||
DIP-gamma | NP_651649.1 | IG_like | 47..139 | CDD:214653 | 32/93 (34%) |
Ig | 47..129 | CDD:299845 | 30/83 (36%) | ||
Ig | 140..238 | CDD:299845 | 30/109 (28%) | ||
IG_like | 247..355 | CDD:214653 | |||
Ig | 256..351 | CDD:299845 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 41 | 1.000 | Domainoid score | I12439 |
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |