DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr1 and DIP-gamma

DIOPT Version :9

Sequence 1:NP_001286645.1 Gene:dpr1 / 2768858 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_651649.1 Gene:DIP-gamma / 43417 FlyBaseID:FBgn0039617 Length:413 Species:Drosophila melanogaster


Alignment Length:206 Identity:63/206 - (30%)
Similarity:88/206 - (42%) Gaps:26/206 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 NLTVTVGQTGFLHCRVERLGDKDVSWIRKRDLHILTAGGTTYTSDQRFQVLRPDGSANWTLQIKY 126
            |:|...|:...|.|.|..||...|.|:|..|..:|...|...|.:.|..|:..| ...|.|:|..
  Fly    47 NVTYPAGREAILACSVRNLGKNKVGWLRASDQTVLALQGRVVTHNARISVMHQD-MHTWKLKISK 110

  Fly   127 PQPRDSGVYECQINTEPKMSLSYTFNVVELKAEIF---GPSDLMVKTGSDINLTCKIMQGPHELG 188
            .:..|.|.|.|||||.| |........|::..:|.   ..:||.|:.|.|..||||....|..  
  Fly   111 LRESDRGCYMCQINTSP-MKKQVGCIDVQVPPDIINEESSADLAVQEGEDATLTCKATGNPQP-- 172

  Fly   189 NIFWYK--GSEMLDGK-GENEIDSSMARIRVEDDWTDGLTSRLKIKRAMPGDTGNYTCV------ 244
            .:.|.:  |..:|..| |..|:      ::||.  .:|  |.|::.|......|.|.|:      
  Fly   173 RVTWRREDGEMILIRKPGSREL------MKVES--YNG--SSLRLLRLERRQMGAYLCIASNDVP 227

  Fly   245 PTVAKTSSVYV 255
            |.|:|..|:.|
  Fly   228 PAVSKRVSLSV 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr1NP_001286645.1 Ig 59..154 CDD:299845 31/91 (34%)
IG_like 60..150 CDD:214653 31/87 (36%)
IG_like 163..257 CDD:214653 30/102 (29%)
Ig 174..244 CDD:143165 19/72 (26%)
DIP-gammaNP_651649.1 IG_like 47..139 CDD:214653 32/93 (34%)
Ig 47..129 CDD:299845 30/83 (36%)
Ig 140..238 CDD:299845 30/109 (28%)
IG_like 247..355 CDD:214653
Ig 256..351 CDD:299845
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 41 1.000 Domainoid score I12439
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.