DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr1 and Dscam3

DIOPT Version :9

Sequence 1:NP_001286645.1 Gene:dpr1 / 2768858 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_996226.2 Gene:Dscam3 / 42103 FlyBaseID:FBgn0261046 Length:2087 Species:Drosophila melanogaster


Alignment Length:246 Identity:61/246 - (24%)
Similarity:90/246 - (36%) Gaps:61/246 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 SPSNLLPYFDFDVPRNLTVTVGQTGFLHCRVERLGDKDV--SWIRKRDLHILTAGGTTYTSDQRF 109
            ||..:.|   |..|:||  ..|....:.|.|.. ||..:  || :|.|..|.::...|...::.:
  Fly   632 SPPVIEP---FKFPKNL--QEGGRAQITCAVSS-GDMPIYFSW-KKDDSSIPSSLQITEKKEEFY 689

  Fly   110 QVLRPDGSANWTLQIKYPQPRDSGVYECQI-NTEPKMSLSYTFNVVELKAEI-----FGPSDLMV 168
            .:          |..|....|.||.|.|.. |...|  ::||   .||:..:     :.|.|..:
  Fly   690 SL----------LVFKDISARHSGKYTCYASNAAAK--VNYT---AELQVRVAPRWRYEPMDTAI 739

  Fly   169 KTGSDINLTCKIMQGPHELGNIFWYKGSEMLDGKGENEIDSSMARIRVEDDWTDGLTSRLKIKRA 233
            ..|:.|::.|:....|  :..|.|:||    .|||..:......|           ...|.:..|
  Fly   740 MLGNTISINCEAEGYP--IPTITWFKG----QGKGSKDFKPLSMR-----------NHSLLLNLA 787

  Fly   234 MPGDTGNYTCVPT------VAKTSSVYVHVIIGEHPAAMQ---HNSSSNSN 275
            ...|.|.|.|..|      :.||..:.|:     .||..:   .|.||..|
  Fly   788 TDNDEGYYMCQATNEIGAGLKKTIRINVN-----EPARFEQSARNISSRRN 833

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr1NP_001286645.1 Ig 59..154 CDD:299845 25/97 (26%)
IG_like 60..150 CDD:214653 23/92 (25%)
IG_like 163..257 CDD:214653 24/99 (24%)
Ig 174..244 CDD:143165 16/69 (23%)
Dscam3NP_996226.2 IG 56..133 CDD:214652
Ig 56..125 CDD:143165
I-set 246..337 CDD:254352
Ig 264..334 CDD:143165
I-set 345..433 CDD:254352
Ig 358..431 CDD:143165
Ig 456..533 CDD:143165
IGc2 553..619 CDD:197706
I-set 634..724 CDD:254352 29/111 (26%)
ig 645..712 CDD:278476 19/80 (24%)
IG_like 734..815 CDD:214653 23/97 (24%)
Ig 745..815 CDD:299845 20/86 (23%)
I-set 820..913 CDD:254352 4/14 (29%)
Ig 838..920 CDD:299845
FN3 917..1033 CDD:238020
FN3 1040..1142 CDD:238020
fn3 1150..1237 CDD:278470
FN3 1263..1345 CDD:238020
Ig 1350..1436 CDD:299845
IG_like 1358..1436 CDD:214653
FN3 1441..1530 CDD:238020
FN3 1542..1620 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.