DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr1 and dpr15

DIOPT Version :9

Sequence 1:NP_001286645.1 Gene:dpr1 / 2768858 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_001287299.1 Gene:dpr15 / 41473 FlyBaseID:FBgn0037993 Length:662 Species:Drosophila melanogaster


Alignment Length:339 Identity:105/339 - (30%)
Similarity:152/339 - (44%) Gaps:49/339 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 APTPPTTST--TT---ISPSNLLPYFDFDVPRNLTVTVGQTGFLHCRVERLGDKDVSWIRKRDLH 94
            |.|.|||:|  ||   ::.:.|.|....|..:.:....|...:|.|.|::|..|.:||:|.||.|
  Fly   166 ATTTPTTTTRRTTRRPVATTTLKPPPTIDDYQTIISQAGTHAYLPCNVKQLVKKPISWLRMRDGH 230

  Fly    95 ILTAGGTTYTSDQRFQVLRPDGSANWTLQIKYPQPRDSGVYECQINTEPKMSLSYTFNVVELKAE 159
            |||...||:.:|||||.:.......|:|||||.|.:|.|.||||::||||.|......:||.|.|
  Fly   231 ILTVDQTTFIADQRFQSVFSPNPERWSLQIKYVQLKDEGTYECQVSTEPKASAIVHLRIVEPKTE 295

  Fly   160 IFGPSDLMVKTGSDINLTCKIMQGPHELGNIFWYKGSEML---DGKG-ENEIDSSMARIRVEDDW 220
            :.|.|...||.||.:.|.|.|.|.......|.|:...:.:   :.:| ..||:            
  Fly   296 LIGESTRHVKAGSQVKLRCIISQALEPPLFINWFYNQKQIYLHNRRGWRTEIE------------ 348

  Fly   221 TDGLTSRLKIKRAMPGDTGNYTCVPTVAKTSSVYVHVIIGEHPA-----AMQHNSSSNSNSFYCG 280
                  |:.:...:|..:...|...|.|.|::......    ||     |......:.|:....|
  Fly   349 ------RIDLPAEVPTTSTTTTTTTTTASTTTTTTSTT----PATPSTTATGSTEGATSSETLNG 403

  Fly   281 ICCMLLSIVSCCLQHFYETGCGYLHAAAALA-----KSAGLGPPKRATLTTSET----GISAAEV 336
            :..:..|.:   |....:.....|.|||.:|     .:|.|.....||.:||.|    |:.|:..
  Fly   404 LVTITRSYI---LDAISQNDVSELGAAAGVAVATETSTAQLLTEVEATSSTSGTSTGAGLLASTS 465

  Fly   337 AA-AAGASAAVASA 349
            || ||||:|.:.:|
  Fly   466 AAYAAGAAAGITTA 479

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr1NP_001286645.1 Ig 59..154 CDD:299845 40/94 (43%)
IG_like 60..150 CDD:214653 40/89 (45%)
IG_like 163..257 CDD:214653 20/97 (21%)
Ig 174..244 CDD:143165 12/73 (16%)
dpr15NP_001287299.1 IG_like 197..289 CDD:214653 40/91 (44%)
V-set 204..290 CDD:284989 40/85 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.