DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr1 and dpr17

DIOPT Version :9

Sequence 1:NP_001286645.1 Gene:dpr1 / 2768858 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_001287297.1 Gene:dpr17 / 41470 FlyBaseID:FBgn0051361 Length:664 Species:Drosophila melanogaster


Alignment Length:269 Identity:92/269 - (34%)
Similarity:138/269 - (51%) Gaps:41/269 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 AALAPTPPTTS-TTTISP------------SNLLPYFD------FDVPRNLTVTV-------GQT 70
            ||.|....|:| ..|:||            |.|..:.|      ..|.||||:.|       |..
  Fly   358 AAQAAAAKTSSEAVTMSPEEQRRQMFNEQHSYLAAHRDGGDGAGSAVRRNLTMPVLNITAQMGNH 422

  Fly    71 GFLHCRVERLGDKDVSWIRKRDLHILTAGGTTYTSDQRFQ-VLRPDGSANWTLQIKYPQPRDSGV 134
            .::.|::.||.||.|||:|.||.||::...||:.:|:||| :.:.|....|:|||||.:|.|:|.
  Fly   423 AYMPCQIHRLSDKPVSWVRMRDNHIISVDETTFIADERFQSIYQEDHDYTWSLQIKYVEPSDAGW 487

  Fly   135 YECQINTEPKMSLSYTFNVVELKAEIFGPSDLMVKTGSDINLTCKIMQG---PHELGNIFWYKGS 196
            ||||:.||||:|......:|:.|.|:.|.....||.||.:.|.| |::|   |.:.  |.|::|.
  Fly   488 YECQMATEPKLSAKVHLQIVKPKTELIGDQSRFVKAGSKVALHC-IVRGTLDPPKY--IIWFRGQ 549

  Fly   197 EMLDGKGE-----NEIDSSMARIRVEDDWTDGLTSRLKIKRAMPGDTGNYTCVPTVAKTSSVYVH 256
            :.:....|     .::|.::.....::..|.|   .|.|......|:|||||.|:.:.:.||.:|
  Fly   550 KKISDSDERTGWYTQLDRNIFGTVGDNQNTIG---SLIIPLVRKEDSGNYTCQPSNSVSVSVDLH 611

  Fly   257 VIIGEHPAA 265
            |:.||:.|:
  Fly   612 VLSGEYSAS 620

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr1NP_001286645.1 Ig 59..154 CDD:299845 45/102 (44%)
IG_like 60..150 CDD:214653 44/97 (45%)
IG_like 163..257 CDD:214653 27/101 (27%)
Ig 174..244 CDD:143165 19/77 (25%)
dpr17NP_001287297.1 IG_like 414..491 CDD:214653 32/76 (42%)
Ig 415..507 CDD:299845 39/91 (43%)
IG_like 521..612 CDD:214653 27/96 (28%)
IGc2 524..605 CDD:197706 23/86 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D104656at50557
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.